Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R4700_RS08075 Genome accession   NZ_CP137112
Coordinates   1568485..1568634 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 02H2025     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1563485..1573634
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R4700_RS08040 blpC 1563752..1563880 (-) 129 WP_000358815.1 quorum-sensing system pheromone BlpC -
  R4700_RS08045 - 1563937..1565298 (-) 1362 WP_277770851.1 bacteriocin secretion accessory protein -
  R4700_RS11130 blpA 1565309..1567466 (-) 2158 Protein_1543 peptide cleavage/export ABC transporter BlpA -
  R4700_RS08065 blpM 1567768..1568022 (+) 255 WP_277770852.1 two-peptide bacteriocin subunit BlpM -
  R4700_RS08070 blpN 1568038..1568241 (+) 204 WP_001099490.1 two-peptide bacteriocin subunit BlpN -
  R4700_RS08075 cipB 1568485..1568634 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  R4700_RS11135 - 1568670..1568735 (+) 66 Protein_1547 ComC/BlpC family peptide pheromone/bacteriocin -
  R4700_RS08080 - 1568738..1568857 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  R4700_RS08085 - 1569325..1569696 (+) 372 WP_033705507.1 hypothetical protein -
  R4700_RS08090 - 1569857..1570826 (+) 970 Protein_1550 thioredoxin domain-containing protein -
  R4700_RS08095 - 1571073..1571306 (+) 234 WP_033705506.1 bacteriocin class II family protein -
  R4700_RS08100 - 1571338..1572027 (+) 690 WP_054370534.1 CPBP family intramembrane glutamic endopeptidase -
  R4700_RS08105 blpZ 1572069..1572317 (+) 249 WP_000276501.1 immunity protein BlpZ -
  R4700_RS08110 - 1572347..1572958 (+) 612 WP_000394036.1 CPBP family intramembrane glutamic endopeptidase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=896054 R4700_RS08075 WP_001809846.1 1568485..1568634(+) (cipB) [Streptococcus pneumoniae strain 02H2025]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=896054 R4700_RS08075 WP_001809846.1 1568485..1568634(+) (cipB) [Streptococcus pneumoniae strain 02H2025]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531