Detailed information NTG0895925

Bioinformatically predicted

Overview

• Name: cipB
• Type: Regulator
• Locus tag: R4706_RS02890
• Genome accession: NZ_CP137111
• Coordinates: 583531..583680 (-)
• Length: 49 a.a.
• NCBI ID: WP_001808912.1
• Uniprot ID: A0A4J1ZTW6
• Organism: Streptococcus pneumoniae strain 17023
• Function: indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	584358..585162	583531..583680	flank	678

Gene organization within MGE regions

Location: 583531..585162

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R4706_RS02890	cipB	583531..583680 (-)	150	WP_001808912.1	bacteriocin-like peptide BlpO	Regulator
R4706_RS02895	-	583924..584208 (-)	285	WP_050205793.1	Blp family class II bacteriocin	-

Sequence

Protein

• Length: 49 a.a.
• Molecular weight: 5150.86 Da
• Isoelectric Point: 3.7098

>NTDB_id=895925 R4706_RS02890 WP_001808912.1 583531..583680(-) (cipB) [Streptococcus pneumoniae strain 17023]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV

Nucleotide

• Length: 150 bp

>NTDB_id=895925 R4706_RS02890 WP_001808912.1 583531..583680(-) (cipB) [Streptococcus pneumoniae strain 17023]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

• Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc) (6-41)

3D structure

• AlphaFold DB: A0A4J1ZTW6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
cipB	Streptococcus mutans UA159	51.02	100	0.51