Detailed information    

insolico Bioinformatically predicted

Overview

Name   HI0659   Type   Machinery gene
Locus tag   R4704_RS08460 Genome accession   NZ_CP137109
Coordinates   1620339..1620605 (+) Length   88 a.a.
NCBI ID   WP_001844589.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain 11012     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 1600821..1619511 1620339..1620605 flank 828
IScluster/Tn 1619766..1620261 1620339..1620605 flank 78


Gene organization within MGE regions


Location: 1600821..1620605
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R4704_RS08380 - 1600821..1602443 (+) 1623 WP_224756958.1 ATP-binding protein -
  R4704_RS08385 - 1602445..1602654 (+) 210 WP_050249033.1 hypothetical protein -
  R4704_RS08390 - 1602691..1602816 (+) 126 Protein_1612 DNA (cytosine-5-)-methyltransferase -
  R4704_RS08395 - 1603034..1603837 (+) 804 WP_001183270.1 Fic/DOC family protein -
  R4704_RS08400 - 1604334..1606892 (+) 2559 WP_000442369.1 TOTE conflict system archaeo-eukaryotic primase domain-containing protein -
  R4704_RS08405 licT 1607192..1608031 (+) 840 WP_317830298.1 BglG family transcription antiterminator LicT -
  R4704_RS08410 - 1608049..1609887 (+) 1839 WP_033707989.1 beta-glucoside-specific PTS transporter subunit IIABC -
  R4704_RS08415 - 1609900..1611315 (+) 1416 WP_033707988.1 glycoside hydrolase family 1 protein -
  R4704_RS08420 pheS 1611798..1612844 (+) 1047 WP_001836415.1 phenylalanine--tRNA ligase subunit alpha -
  R4704_RS08425 - 1612844..1613353 (+) 510 WP_000619941.1 N-acetyltransferase -
  R4704_RS08430 pheT 1613430..1615835 (+) 2406 WP_033707986.1 phenylalanine--tRNA ligase subunit beta -
  R4704_RS08435 - 1615903..1616907 (-) 1005 WP_016398280.1 endonuclease/exonuclease/phosphatase family protein -
  R4704_RS08440 - 1616928..1617611 (-) 684 WP_000743644.1 DUF6973 domain-containing protein -
  R4704_RS08445 - 1617883..1618392 (-) 510 WP_001066470.1 hypothetical protein -
  R4704_RS08450 - 1618630..1619511 (+) 882 WP_001267157.1 helix-turn-helix transcriptional regulator -
  R4704_RS08455 - 1619766..1620255 (+) 490 Protein_1625 transposase -
  R4704_RS08460 HI0659 1620339..1620605 (+) 267 WP_001844589.1 helix-turn-helix domain-containing protein Machinery gene

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9629.24 Da        Isoelectric Point: 5.1633

>NTDB_id=895825 R4704_RS08460 WP_001844589.1 1620339..1620605(+) (HI0659) [Streptococcus pneumoniae strain 11012]
MEGCPSELFSKEEILESDMRVAIMSELIEARNKQGISQKKLEELSGVSQPVIARMETGKTSPQLDTVLKVLASLGKILAV
VRLEQGKS

Nucleotide


Download         Length: 267 bp        

>NTDB_id=895825 R4704_RS08460 WP_001844589.1 1620339..1620605(+) (HI0659) [Streptococcus pneumoniae strain 11012]
TTGGAAGGATGTCCATCTGAGCTCTTTAGCAAGGAGGAAATCCTTGAAAGTGATATGCGAGTAGCTATCATGAGCGAGTT
GATTGAAGCCAGAAATAAGCAAGGAATCAGTCAGAAAAAGCTAGAGGAACTCAGTGGAGTGAGTCAGCCTGTTATAGCTA
GGATGGAGACAGGTAAGACTAGTCCACAGTTGGACACAGTCTTAAAAGTCCTAGCTAGTCTAGGAAAGATACTAGCAGTC
GTCCGACTTGAACAGGGGAAAAGTTGA

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(28-75)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  HI0659 Haemophilus influenzae Rd KW20

59.74

87.5

0.523