Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R4711_RS02905 Genome accession   NZ_CP137107
Coordinates   580198..580347 (-) Length   49 a.a.
NCBI ID   WP_001813641.1    Uniprot ID   A0A6I3TPS6
Organism   Streptococcus pneumoniae strain 15H4024     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 581266..582071 580198..580347 flank 919


Gene organization within MGE regions


Location: 580198..582071
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R4711_RS02905 cipB 580198..580347 (-) 150 WP_001813641.1 bacteriocin-like peptide BlpO Regulator
  R4711_RS02910 blpN 580591..580794 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  R4711_RS02915 blpM 580810..581064 (-) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  R4711_RS02920 - 581266..582071 (-) 806 Protein_581 IS5 family transposase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5164.93 Da        Isoelectric Point: 3.9133

>NTDB_id=895613 R4711_RS02905 WP_001813641.1 580198..580347(-) (cipB) [Streptococcus pneumoniae strain 15H4024]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=895613 R4711_RS02905 WP_001813641.1 580198..580347(-) (cipB) [Streptococcus pneumoniae strain 15H4024]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I3TPS6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

48.98

100

0.49