Detailed information NTG0895133

Bioinformatically predicted

Overview

• Name: cipB
• Type: Regulator
• Locus tag: R4703_RS08660
• Genome accession: NZ_CP137100
• Coordinates: 1597024..1597173 (+)
• Length: 49 a.a.
• NCBI ID: WP_001820573.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae strain LYP
• Function: indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	1595768..1596157	1597024..1597173	flank	867

Gene organization within MGE regions

Location: 1595768..1597173

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R4703_RS08650	blpM	1596307..1596561 (+)	255	WP_000379877.1	two-peptide bacteriocin subunit BlpM	-
R4703_RS08655	blpN	1596577..1596780 (+)	204	WP_001099492.1	two-peptide bacteriocin subunit BlpN	-
R4703_RS08660	cipB	1597024..1597173 (+)	150	WP_001820573.1	bacteriocin-like peptide BlpO	Regulator

Sequence

Protein

• Length: 49 a.a.
• Molecular weight: 5150.91 Da
• Isoelectric Point: 3.9133

>NTDB_id=895133 R4703_RS08660 WP_001820573.1 1597024..1597173(+) (cipB) [Streptococcus pneumoniae strain LYP]
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide

• Length: 150 bp

>NTDB_id=895133 R4703_RS08660 WP_001820573.1 1597024..1597173(+) (cipB) [Streptococcus pneumoniae strain LYP]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

• Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc) (6-44)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
cipB	Streptococcus mutans UA159	51.02	100	0.51