Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AAYR29_RS03745 Genome accession   NZ_CP154918
Coordinates   643401..643574 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain FUA2231     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 638401..648574
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAYR29_RS03700 (AAYR29_03700) comGE 638752..639099 (+) 348 WP_345806076.1 ComG operon protein 5 Machinery gene
  AAYR29_RS03705 (AAYR29_03705) comGF 639125..639508 (+) 384 WP_345806077.1 ComG operon protein ComGF Machinery gene
  AAYR29_RS03710 (AAYR29_03710) comGG 639509..639883 (+) 375 WP_345806078.1 ComG operon protein ComGG Machinery gene
  AAYR29_RS03715 (AAYR29_03715) spoIIT 639954..640133 (+) 180 WP_003230176.1 YqzE family protein -
  AAYR29_RS03720 (AAYR29_03720) yqzG 640175..640501 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  AAYR29_RS03725 (AAYR29_03725) tapA 640773..641534 (+) 762 WP_345806079.1 amyloid fiber anchoring/assembly protein TapA -
  AAYR29_RS03730 (AAYR29_03730) sipW 641518..642090 (+) 573 WP_072692741.1 signal peptidase I -
  AAYR29_RS03735 (AAYR29_03735) tasA 642154..642939 (+) 786 WP_345806080.1 biofilm matrix protein TasA -
  AAYR29_RS03740 (AAYR29_03740) sinR 643032..643367 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AAYR29_RS03745 (AAYR29_03745) sinI 643401..643574 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  AAYR29_RS03750 (AAYR29_03750) yqhG 643757..644551 (-) 795 WP_003230200.1 YqhG family protein -
  AAYR29_RS03755 (AAYR29_03755) yqhH 644572..646245 (-) 1674 WP_003230203.1 SNF2-related protein -
  AAYR29_RS03760 (AAYR29_03760) gcvT 646687..647775 (+) 1089 WP_345806081.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=894931 AAYR29_RS03745 WP_003230187.1 643401..643574(-) (sinI) [Bacillus subtilis strain FUA2231]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=894931 AAYR29_RS03745 WP_003230187.1 643401..643574(-) (sinI) [Bacillus subtilis strain FUA2231]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1