Detailed information NTG0893577

Bioinformatically predicted

Overview

• Name: comS
• Type: Regulator
• Locus tag: R3H37_RS00340
• Genome accession: NZ_CP136948
• Coordinates: 55342..55440 (+)
• Length: 32 a.a.
• NCBI ID: WP_020833188.1
• Uniprot ID: -
• Organism: Streptococcus pyogenes strain Spyo01
• Function: activate transcription of comX (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	53962..55152	55342..55440	flank	190

Gene organization within MGE regions

Location: 53962..55440

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R3H37_RS00335 (R3H37_00335)	-	53962..55152 (-)	1191	WP_002299749.1	IS256-like element ISLgar5 family transposase	-
R3H37_RS00340 (R3H37_00340)	comS	55342..55440 (+)	99	WP_020833188.1	quorum-sensing system DWW-type pheromone	Regulator

Sequence

Protein

• Length: 32 a.a.
• Molecular weight: 3758.63 Da
• Isoelectric Point: 10.7919

>NTDB_id=893577 R3H37_RS00340 WP_020833188.1 55342..55440(+) (comS) [Streptococcus pyogenes strain Spyo01]
MLKKVKPFLLLAAVVAFKVARVMHEFDWWNLG

Nucleotide

• Length: 99 bp

>NTDB_id=893577 R3H37_RS00340 WP_020833188.1 55342..55440(+) (comS) [Streptococcus pyogenes strain Spyo01]
ATGTTAAAAAAAGTTAAGCCATTTTTACTATTAGCCGCAGTAGTTGCATTTAAAGTTGCTCGTGTAATGCATGAATTTGA
TTGGTGGAATCTTGGTTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comS	Streptococcus pyogenes MGAS315	100	100	1
comS	Streptococcus pyogenes MGAS8232	45.161	96.875	0.437