Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   AAIS09_RS02455 Genome accession   NZ_CP154595
Coordinates   477501..477650 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   Q9FBH1
Organism   Streptococcus pneumoniae strain serotype 4     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 472501..482650
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAIS09_RS02430 (AAIS09_02425) - 474103..474306 (+) 204 WP_001093272.1 bacteriocin class II family protein -
  AAIS09_RS02435 (AAIS09_02430) - 474624..474827 (+) 204 WP_000411016.1 hypothetical protein -
  AAIS09_RS02440 (AAIS09_02435) - 475830..476634 (+) 805 Protein_479 IS5 family transposase -
  AAIS09_RS02445 (AAIS09_02440) blpM 476784..477038 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  AAIS09_RS02450 (AAIS09_02445) blpN 477054..477257 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  AAIS09_RS02455 (AAIS09_02450) cipB 477501..477650 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  AAIS09_RS02460 (AAIS09_02455) - 477754..477873 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  AAIS09_RS02465 (AAIS09_02460) - 478659..479042 (+) 384 WP_000877381.1 hypothetical protein -
  AAIS09_RS02470 (AAIS09_02465) - 479094..479783 (+) 690 WP_369917411.1 CPBP family intramembrane glutamic endopeptidase -
  AAIS09_RS02475 (AAIS09_02470) blpZ 479825..479995 (+) 171 Protein_486 immunity protein BlpZ -
  AAIS09_RS02480 (AAIS09_02475) - 480209..480820 (+) 612 WP_000394039.1 CPBP family intramembrane glutamic endopeptidase -
  AAIS09_RS02485 (AAIS09_02480) ccrZ 480981..481775 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -
  AAIS09_RS02490 (AAIS09_02485) trmB 481772..482407 (+) 636 WP_016397843.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=893443 AAIS09_RS02455 WP_001818346.1 477501..477650(+) (cipB) [Streptococcus pneumoniae strain serotype 4]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=893443 AAIS09_RS02455 WP_001818346.1 477501..477650(+) (cipB) [Streptococcus pneumoniae strain serotype 4]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9FBH1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51