Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R1Y14_RS04225 Genome accession   NZ_CP136899
Coordinates   810605..810754 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain ST62     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 805605..815754
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R1Y14_RS04200 (R1Y14_04200) blpC 805869..806024 (-) 156 WP_000358812.1 quorum-sensing system pheromone BlpC -
  R1Y14_RS04205 (R1Y14_04205) - 806081..807442 (-) 1362 WP_001069065.1 bacteriocin secretion accessory protein -
  R1Y14_RS04210 (R1Y14_04210) comA/nlmT 807453..809606 (-) 2154 WP_000205159.1 peptide cleavage/export ABC transporter BlpA Regulator
  R1Y14_RS04215 (R1Y14_04215) blpM 809888..810142 (+) 255 WP_001093255.1 two-peptide bacteriocin subunit BlpM -
  R1Y14_RS04220 (R1Y14_04220) blpN 810158..810361 (+) 204 WP_001099490.1 two-peptide bacteriocin subunit BlpN -
  R1Y14_RS04225 (R1Y14_04225) cipB 810605..810754 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  R1Y14_RS04230 (R1Y14_04230) - 810858..810977 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  R1Y14_RS04235 (R1Y14_04235) - 811458..811816 (+) 359 Protein_793 immunity protein -
  R1Y14_RS04240 (R1Y14_04240) - 812169..812362 (+) 194 Protein_794 hypothetical protein -
  R1Y14_RS04245 (R1Y14_04245) - 812445..812828 (+) 384 WP_000877381.1 hypothetical protein -
  R1Y14_RS04250 (R1Y14_04250) - 812880..813569 (+) 690 WP_000760515.1 CPBP family intramembrane glutamic endopeptidase -
  R1Y14_RS04255 (R1Y14_04255) blpZ 813611..813859 (+) 249 WP_000276499.1 immunity protein BlpZ -
  R1Y14_RS04260 (R1Y14_04260) - 813889..814500 (+) 612 WP_000394030.1 CPBP family intramembrane glutamic endopeptidase -
  R1Y14_RS04265 (R1Y14_04265) ccrZ 814662..815456 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=893242 R1Y14_RS04225 WP_001809846.1 810605..810754(+) (cipB) [Streptococcus pneumoniae strain ST62]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=893242 R1Y14_RS04225 WP_001809846.1 810605..810754(+) (cipB) [Streptococcus pneumoniae strain ST62]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531