Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   AAHH81_RS02460 Genome accession   NZ_CP152418
Coordinates   477500..477649 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   Q9FBH1
Organism   Streptococcus pneumoniae strain 20234287     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 472500..482649
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAHH81_RS02435 (AAHH81_02430) - 474102..474305 (+) 204 WP_001093272.1 bacteriocin class II family protein -
  AAHH81_RS02440 (AAHH81_02435) - 474623..474826 (+) 204 WP_000411016.1 hypothetical protein -
  AAHH81_RS02445 (AAHH81_02440) - 475829..476633 (+) 805 Protein_480 IS5 family transposase -
  AAHH81_RS02450 (AAHH81_02445) blpM 476783..477037 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  AAHH81_RS02455 (AAHH81_02450) blpN 477053..477256 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  AAHH81_RS02460 (AAHH81_02455) cipB 477500..477649 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  AAHH81_RS02465 (AAHH81_02460) - 477753..477872 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  AAHH81_RS02470 (AAHH81_02465) - 478658..479041 (+) 384 WP_000877381.1 hypothetical protein -
  AAHH81_RS02475 (AAHH81_02470) - 479093..479782 (+) 690 WP_369917411.1 CPBP family intramembrane glutamic endopeptidase -
  AAHH81_RS02480 (AAHH81_02475) blpZ 479824..479994 (+) 171 Protein_487 immunity protein BlpZ -
  AAHH81_RS02485 (AAHH81_02480) - 480208..480819 (+) 612 WP_000394039.1 CPBP family intramembrane glutamic endopeptidase -
  AAHH81_RS02490 (AAHH81_02485) ccrZ 480980..481774 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -
  AAHH81_RS02495 (AAHH81_02490) trmB 481771..482406 (+) 636 WP_016397843.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=892468 AAHH81_RS02460 WP_001818346.1 477500..477649(+) (cipB) [Streptococcus pneumoniae strain 20234287]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=892468 AAHH81_RS02460 WP_001818346.1 477500..477649(+) (cipB) [Streptococcus pneumoniae strain 20234287]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9FBH1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51