Detailed information    

insolico Bioinformatically predicted

Overview

Name   luxP   Type   Regulator
Locus tag   OCV04_RS17140 Genome accession   NZ_AP024894
Coordinates   550084..551172 (+) Length   362 a.a.
NCBI ID   WP_171138156.1    Uniprot ID   -
Organism   Vibrio plantisponsor strain CECT 7581     
Function   autoinducer sensor (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 534725..602804 550084..551172 within 0


Gene organization within MGE regions


Location: 534725..602804
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OCV04_RS17065 - 536885..538111 (+) 1227 WP_171138162.1 lipopolysaccharide biosynthesis protein -
  OCV04_RS17070 - 538108..539499 (+) 1392 WP_171138161.1 capsular biosynthesis protein -
  OCV04_RS17075 - 539492..540490 (+) 999 WP_171138181.1 glycosyltransferase family 2 protein -
  OCV04_RS17080 - 540487..541698 (+) 1212 WP_171138160.1 glycosyltransferase family 4 protein -
  OCV04_RS17085 - 541700..542803 (+) 1104 WP_171138159.1 glycosyltransferase family 4 protein -
  OCV04_RS17090 - 542828..543232 (+) 405 WP_102942590.1 hypothetical protein -
  OCV04_RS17095 - 543251..544759 (+) 1509 WP_102942589.1 DUF4832 domain-containing protein -
  OCV04_RS17100 - 544868..545128 (-) 261 WP_102942588.1 YgjV family protein -
  OCV04_RS17105 - 545475..545891 (-) 417 WP_171138158.1 VOC family protein -
  OCV04_RS17110 - 546008..546535 (-) 528 WP_102942632.1 DUF4823 domain-containing protein -
  OCV04_RS17115 - 546787..547104 (-) 318 WP_042487222.1 DUF496 family protein -
  OCV04_RS17120 - 547293..547490 (+) 198 WP_146027686.1 hypothetical protein -
  OCV04_RS17125 - 547537..548187 (+) 651 WP_102942585.1 YceH family protein -
  OCV04_RS17130 - 548187..548486 (+) 300 WP_171138157.1 GIY-YIG nuclease family protein -
  OCV04_RS17135 - 548636..549787 (+) 1152 WP_102942583.1 conjugal transfer protein TraF -
  OCV04_RS17140 luxP 550084..551172 (+) 1089 WP_171138156.1 autoinducer 2-binding periplasmic protein LuxP Regulator
  OCV04_RS17145 luxQ 551190..553739 (+) 2550 WP_315972714.1 quorum-sensing autoinducer 2 sensor kinase/phosphatase LuxQ Regulator
  OCV04_RS17150 - 553773..554441 (-) 669 WP_171138155.1 PilZ domain-containing protein -
  OCV04_RS17155 - 554578..555102 (-) 525 WP_171138154.1 hypothetical protein -
  OCV04_RS17160 - 555324..556805 (+) 1482 WP_171138153.1 cobyric acid synthase -
  OCV04_RS17165 modA 556807..557580 (+) 774 WP_171138152.1 molybdate ABC transporter substrate-binding protein -
  OCV04_RS17170 modB 557585..558277 (+) 693 WP_171138179.1 molybdate ABC transporter permease subunit -
  OCV04_RS17175 modC 558274..559386 (+) 1113 WP_171138151.1 molybdenum ABC transporter ATP-binding protein ModC -
  OCV04_RS17180 - 559401..559688 (-) 288 WP_171138150.1 hypothetical protein -
  OCV04_RS17185 - 559763..559924 (-) 162 WP_167828610.1 hypothetical protein -
  OCV04_RS17190 yccS 560128..562302 (-) 2175 WP_171138149.1 YccS family putative transporter -
  OCV04_RS17195 helD 562489..564552 (+) 2064 WP_171138178.1 DNA helicase IV -
  OCV04_RS17200 pncA 564564..565181 (+) 618 WP_171138148.1 bifunctional nicotinamidase/pyrazinamidase -
  OCV04_RS17205 - 565262..565717 (-) 456 WP_102942573.1 methylglyoxal synthase -
  OCV04_RS17210 glgC 565996..567249 (-) 1254 WP_258004335.1 glucose-1-phosphate adenylyltransferase -
  OCV04_RS17215 - 567490..568059 (-) 570 WP_171138147.1 hypothetical protein -
  OCV04_RS17220 - 568198..568860 (+) 663 WP_171138146.1 SH3 domain-containing protein -
  OCV04_RS17225 - 569096..569476 (+) 381 WP_171138145.1 STAS/SEC14 domain-containing protein -
  OCV04_RS17230 - 569546..569947 (+) 402 WP_240956712.1 MazG nucleotide pyrophosphohydrolase domain-containing protein -
  OCV04_RS17235 - 570052..570519 (+) 468 WP_102942568.1 OsmC family protein -
  OCV04_RS17240 - 570548..571126 (+) 579 WP_171138144.1 DJ-1/PfpI family protein -
  OCV04_RS17245 - 571158..571994 (-) 837 WP_240956711.1 EAL domain-containing protein -
  OCV04_RS17250 - 572299..573087 (-) 789 WP_171138143.1 lipase -
  OCV04_RS17255 - 573195..573830 (-) 636 WP_102942565.1 hypothetical protein -
  OCV04_RS17260 - 574032..574280 (+) 249 WP_102942564.1 DUF2164 domain-containing protein -
  OCV04_RS17265 - 574453..574989 (+) 537 WP_171138142.1 cytochrome b -
  OCV04_RS17270 - 574989..575558 (+) 570 WP_171138141.1 YceI family protein -
  OCV04_RS17275 focA 575643..577094 (-) 1452 WP_102942561.1 formate transporter FocA -
  OCV04_RS17280 - 577313..578218 (+) 906 WP_102942560.1 LysR substrate-binding domain-containing protein -
  OCV04_RS17285 - 578453..578947 (+) 495 WP_171138140.1 DUF1097 domain-containing protein -
  OCV04_RS17290 - 579078..580709 (-) 1632 WP_102942559.1 ATP-dependent endonuclease -
  OCV04_RS17295 - 580959..582704 (+) 1746 WP_171138139.1 bifunctional UDP-sugar hydrolase/5'-nucleotidase -
  OCV04_RS17300 - 583538..583729 (+) 192 WP_171138138.1 hypothetical protein -
  OCV04_RS17305 - 583858..584424 (-) 567 WP_171138137.1 PhnA domain-containing protein -
  OCV04_RS17310 - 584595..585677 (+) 1083 WP_171138136.1 metalloprotease -
  OCV04_RS17315 - 585734..586525 (-) 792 WP_171138135.1 M48 family metallopeptidase -
  OCV04_RS17320 - 586642..587094 (+) 453 WP_171138134.1 hotdog fold thioesterase -
  OCV04_RS17325 - 587095..587328 (+) 234 WP_171138133.1 DUF3389 domain-containing protein -
  OCV04_RS17330 - 587410..589116 (+) 1707 WP_102942551.1 SgrR family transcriptional regulator -
  OCV04_RS17335 - 589125..589376 (+) 252 WP_171138132.1 hypothetical protein -
  OCV04_RS17340 - 589892..590779 (+) 888 WP_102942549.1 LysR family transcriptional regulator -
  OCV04_RS17345 - 590833..593517 (-) 2685 WP_171138131.1 bifunctional acetate--CoA ligase family protein/GNAT family N-acetyltransferase -
  OCV04_RS17350 - 593734..594309 (+) 576 WP_102969078.1 SPOR domain-containing protein -
  OCV04_RS17355 - 594459..595463 (+) 1005 WP_171138130.1 D-alanine--D-alanine ligase -
  OCV04_RS17360 - 595447..596406 (-) 960 WP_171138129.1 tyrosine-type recombinase/integrase -
  OCV04_RS17365 - 596508..596882 (+) 375 WP_102942544.1 DUF3319 domain-containing protein -
  OCV04_RS17370 yciH 596884..597195 (+) 312 WP_171138128.1 stress response translation initiation inhibitor YciH -
  OCV04_RS17375 - 597272..597895 (-) 624 WP_171138127.1 DsbA family protein -
  OCV04_RS17380 - 598009..598902 (+) 894 WP_171138126.1 LysR family transcriptional regulator -
  OCV04_RS17385 - 599137..599493 (-) 357 WP_171138125.1 DUF3693 domain-containing protein -
  OCV04_RS17390 - 599682..599879 (+) 198 WP_112404878.1 hypothetical protein -
  OCV04_RS17395 - 599876..601159 (+) 1284 WP_171138124.1 replication initiation factor domain-containing protein -
  OCV04_RS17400 - 601166..601540 (+) 375 WP_171138123.1 DUF1293 family protein -
  OCV04_RS17405 - 601545..601769 (+) 225 WP_102966811.1 hypothetical protein -
  OCV04_RS17410 - 601797..602015 (+) 219 WP_171138122.1 hypothetical protein -

Sequence

Protein


Download         Length: 362 a.a.        Molecular weight: 41200.88 Da        Isoelectric Point: 5.3247

>NTDB_id=89236 OCV04_RS17140 WP_171138156.1 550084..551172(+) (luxP) [Vibrio plantisponsor strain CECT 7581]
MKRALLLSLIFSATPTLSAQVLDGYWHYKEFLTINPTEKDRTLLLAETVRNKPVPISVVQDKPVTISVVYPGQQISDYWV
RNIKAFEKRMEELGIKYQLNQVFTRPNVDMRQQSLSLMEAIKNNTGYLIFTLDTTRHRKFIEHVLNSSDTKLILQNITTP
VQGWEERQPLMYVGFDHELGANQIADYYKQTIPDGSKYSVLYFSEGYISDARGSSFIQMMEENNSYKLSSSFYTKTTEQS
GYESTLKIIEKDPDIKFIYACSTDVALGAAKALKELNRQDIEINGWGGGSAELDAIVKGDLNVTVMRMNDDTGIAMAEAI
KWDIENKPVPLVYSGDLAVVTKEDSKETIEKLKQRAFRYSDN

Nucleotide


Download         Length: 1089 bp        

>NTDB_id=89236 OCV04_RS17140 WP_171138156.1 550084..551172(+) (luxP) [Vibrio plantisponsor strain CECT 7581]
ATGAAAAGAGCCTTATTGCTTTCACTTATTTTTAGTGCCACACCTACATTGTCGGCTCAAGTTCTAGATGGTTATTGGCA
CTATAAAGAGTTTTTAACTATCAACCCAACTGAGAAAGATCGAACCCTTTTGCTTGCCGAAACAGTGCGCAACAAACCTG
TTCCAATCTCAGTCGTTCAAGACAAACCGGTCACTATTTCGGTTGTTTATCCCGGCCAGCAGATTTCAGATTATTGGGTT
CGCAATATCAAAGCTTTTGAAAAGCGAATGGAAGAGTTGGGTATCAAGTATCAATTAAACCAAGTTTTTACTAGGCCAAA
CGTGGATATGAGACAACAAAGCTTGTCTCTGATGGAAGCGATAAAAAATAATACTGGCTACTTAATTTTTACCCTAGACA
CAACACGGCATAGAAAATTCATTGAACACGTGTTGAACTCCTCAGATACCAAACTCATTCTGCAAAACATCACAACACCA
GTACAAGGCTGGGAAGAACGACAACCCTTGATGTATGTAGGTTTCGATCATGAGTTAGGTGCAAATCAAATTGCAGATTA
CTACAAACAAACTATACCGGATGGTAGTAAGTATTCTGTGCTTTATTTTTCTGAGGGCTATATCAGTGACGCTCGTGGGA
GTAGCTTCATTCAAATGATGGAAGAGAATAACAGCTACAAACTTTCTTCCTCTTTTTACACTAAAACGACTGAACAGAGC
GGTTACGAGTCGACATTAAAGATCATCGAAAAAGACCCTGATATTAAGTTCATCTATGCGTGTTCAACCGACGTTGCATT
AGGTGCAGCGAAAGCGTTGAAGGAATTAAATCGTCAGGACATCGAAATTAATGGATGGGGTGGCGGTTCTGCTGAGTTGG
ACGCTATCGTGAAAGGTGATTTGAATGTTACTGTGATGCGAATGAATGATGATACGGGCATTGCAATGGCGGAAGCCATT
AAATGGGACATTGAAAACAAACCTGTACCGCTGGTTTATTCAGGCGATCTCGCTGTCGTCACTAAAGAAGACTCTAAAGA
GACGATAGAAAAACTCAAACAACGCGCTTTCCGATATTCAGATAATTAG

Domains

Predicted by InterproScan.

Periplasmic binding protein domain (Peripla_BP_4)

(66-320)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  luxP Vibrio cholerae strain A1552

68.033

100

0.688

Multiple sequence alignment