Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   R0492_RS18325 Genome accession   NZ_CP136649
Coordinates   3488364..3488648 (-) Length   94 a.a.
NCBI ID   WP_003185421.1    Uniprot ID   A0A1Y0XQV9
Organism   Bacillus licheniformis strain NXU98     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3440019..3490034 3488364..3488648 within 0


Gene organization within MGE regions


Location: 3440019..3490034
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R0492_RS18005 - 3440019..3440237 (-) 219 WP_011198294.1 transcriptional regulator -
  R0492_RS18010 - 3440464..3441033 (+) 570 WP_011198295.1 hypothetical protein -
  R0492_RS18015 - 3441278..3441370 (-) 93 Protein_3498 peptidoglycan-binding domain-containing protein -
  R0492_RS18020 - 3441550..3441780 (-) 231 WP_011198296.1 helix-turn-helix domain-containing protein -
  R0492_RS18025 - 3442035..3442178 (-) 144 WP_021837703.1 hypothetical protein -
  R0492_RS18030 - 3442285..3443307 (-) 1023 WP_011198298.1 hypothetical protein -
  R0492_RS18035 - 3443578..3445107 (+) 1530 WP_011198299.1 T7SS effector LXG polymorphic toxin -
  R0492_RS18040 - 3445123..3445461 (+) 339 WP_011198300.1 hypothetical protein -
  R0492_RS18045 - 3445518..3446597 (-) 1080 WP_011198301.1 N-acetylmuramoyl-L-alanine amidase -
  R0492_RS18050 - 3446649..3446912 (-) 264 WP_011198302.1 phage holin -
  R0492_RS18055 - 3446928..3447197 (-) 270 WP_009329192.1 hemolysin XhlA family protein -
  R0492_RS18060 - 3447260..3447445 (-) 186 WP_003185324.1 XkdX family protein -
  R0492_RS18065 - 3447442..3447765 (-) 324 WP_044789345.1 hypothetical protein -
  R0492_RS18070 - 3447778..3449154 (-) 1377 WP_044789346.1 phage baseplate upper protein -
  R0492_RS18075 - 3449168..3451813 (-) 2646 WP_144619827.1 peptidase G2 autoproteolytic cleavage domain-containing protein -
  R0492_RS18080 - 3451850..3453562 (-) 1713 WP_044789351.1 phage tail protein -
  R0492_RS18085 - 3453575..3454411 (-) 837 WP_044789353.1 phage tail family protein -
  R0492_RS18090 - 3454411..3458880 (-) 4470 WP_016886553.1 phage tail tape measure protein -
  R0492_RS18095 gpG 3459089..3459451 (-) 363 WP_003185339.1 phage tail assembly chaperone G -
  R0492_RS18100 - 3459504..3460121 (-) 618 WP_016886552.1 major tail protein -
  R0492_RS18105 - 3460136..3460519 (-) 384 WP_003185344.1 hypothetical protein -
  R0492_RS18110 - 3460516..3460914 (-) 399 WP_016886551.1 HK97-gp10 family putative phage morphogenesis protein -
  R0492_RS18115 - 3460914..3461222 (-) 309 WP_016886550.1 phage head closure protein -
  R0492_RS18120 - 3461212..3461514 (-) 303 WP_016886549.1 head-tail connector protein -
  R0492_RS18125 - 3461525..3461962 (-) 438 WP_029326520.1 collagen-like protein -
  R0492_RS18130 - 3461987..3463270 (-) 1284 WP_025805204.1 phage major capsid protein -
  R0492_RS18135 - 3463340..3464071 (-) 732 WP_016886547.1 head maturation protease, ClpP-related -
  R0492_RS18140 - 3464016..3465326 (-) 1311 WP_016886546.1 phage portal protein -
  R0492_RS18145 - 3465327..3465518 (-) 192 WP_006637242.1 DUF1056 family protein -
  R0492_RS18150 - 3465530..3467239 (-) 1710 WP_017474887.1 terminase large subunit -
  R0492_RS18155 - 3467236..3467751 (-) 516 WP_011198313.1 phage terminase small subunit P27 family -
  R0492_RS18160 - 3467982..3468356 (-) 375 WP_011198314.1 HNH endonuclease -
  R0492_RS18165 - 3468383..3468691 (-) 309 WP_016886543.1 hypothetical protein -
  R0492_RS18170 cotD 3468908..3469132 (-) 225 WP_006637235.1 spore coat protein CotD -
  R0492_RS18175 - 3469871..3470251 (-) 381 WP_009329244.1 ArpU family phage packaging/lysis transcriptional regulator -
  R0492_RS18180 - 3470378..3470650 (-) 273 WP_011198316.1 DUF5052 family protein -
  R0492_RS18185 - 3470720..3471148 (-) 429 WP_011201737.1 putative metallopeptidase -
  R0492_RS18190 - 3471111..3471233 (-) 123 WP_257227968.1 hypothetical protein -
  R0492_RS18195 - 3471236..3471406 (-) 171 WP_009329251.1 Fur-regulated basic protein FbpA -
  R0492_RS18200 - 3471403..3471942 (-) 540 WP_009329253.1 ERCC4 domain-containing protein -
  R0492_RS18205 - 3471939..3472376 (-) 438 WP_011198317.1 hypothetical protein -
  R0492_RS18210 - 3472354..3472617 (-) 264 WP_016886542.1 hypothetical protein -
  R0492_RS18215 - 3472893..3475325 (-) 2433 WP_016886541.1 phage/plasmid primase, P4 family -
  R0492_RS18220 - 3475386..3475823 (-) 438 WP_003185383.1 DUF669 domain-containing protein -
  R0492_RS18225 - 3475823..3476755 (-) 933 WP_011198320.1 AAA family ATPase -
  R0492_RS18230 - 3476759..3477319 (-) 561 WP_016886540.1 host-nuclease inhibitor Gam family protein -
  R0492_RS18235 - 3477411..3477653 (-) 243 WP_011198322.1 hypothetical protein -
  R0492_RS18240 - 3477741..3478007 (-) 267 WP_009330095.1 YqaH family protein -
  R0492_RS18245 - 3478070..3478621 (+) 552 WP_016886538.1 hypothetical protein -
  R0492_RS18250 - 3478593..3478748 (-) 156 WP_155266364.1 hypothetical protein -
  R0492_RS18255 - 3478874..3479428 (-) 555 WP_003185401.1 hypothetical protein -
  R0492_RS18260 - 3479486..3479674 (-) 189 WP_016886536.1 hypothetical protein -
  R0492_RS18265 - 3479806..3479994 (-) 189 WP_003185403.1 helix-turn-helix transcriptional regulator -
  R0492_RS18270 - 3479991..3480785 (-) 795 WP_016886535.1 ORF6N domain-containing protein -
  R0492_RS18275 - 3480847..3481164 (+) 318 WP_016886534.1 hypothetical protein -
  R0492_RS18280 - 3481127..3481396 (-) 270 WP_016886533.1 hypothetical protein -
  R0492_RS18285 - 3481411..3481650 (-) 240 WP_016886532.1 helix-turn-helix domain-containing protein -
  R0492_RS18290 - 3481807..3482457 (+) 651 WP_016886531.1 LexA family transcriptional regulator -
  R0492_RS18295 - 3482528..3483622 (+) 1095 WP_003185410.1 site-specific integrase -
  R0492_RS18305 smpB 3484174..3484647 (-) 474 WP_009329604.1 SsrA-binding protein SmpB -
  R0492_RS18310 rnr 3484759..3487062 (-) 2304 WP_003185414.1 ribonuclease R -
  R0492_RS18315 - 3487076..3487822 (-) 747 WP_011198329.1 carboxylesterase -
  R0492_RS18320 secG 3487963..3488193 (-) 231 WP_003185418.1 preprotein translocase subunit SecG -
  R0492_RS18325 abrB 3488364..3488648 (-) 285 WP_003185421.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  R0492_RS18330 - 3488677..3488910 (-) 234 WP_085959538.1 helix-turn-helix transcriptional regulator -
  R0492_RS18335 - 3489063..3489464 (+) 402 WP_009329609.1 transcriptional regulator -
  R0492_RS18340 - 3489636..3490034 (+) 399 WP_009329610.1 helix-turn-helix domain-containing protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10486.36 Da        Isoelectric Point: 7.9620

>NTDB_id=892247 R0492_RS18325 WP_003185421.1 3488364..3488648(-) (abrB) [Bacillus licheniformis strain NXU98]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=892247 R0492_RS18325 WP_003185421.1 3488364..3488648(-) (abrB) [Bacillus licheniformis strain NXU98]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(53-85)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(9-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1Y0XQV9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.044

96.809

0.543