Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   R0492_RS13280 Genome accession   NZ_CP136649
Coordinates   2557828..2558004 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain NXU98     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2552828..2563004
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R0492_RS13265 gcvT 2553470..2554564 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  R0492_RS13270 - 2555157..2556836 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  R0492_RS13275 - 2556843..2557637 (+) 795 WP_003183441.1 YqhG family protein -
  R0492_RS13280 sinI 2557828..2558004 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  R0492_RS13285 sinR 2558038..2558373 (+) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  R0492_RS13290 tasA 2558478..2559272 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  R0492_RS13295 sipW 2559346..2559930 (-) 585 WP_003183449.1 signal peptidase I SipW -
  R0492_RS13300 tapA 2559927..2560655 (-) 729 WP_011198112.1 amyloid fiber anchoring/assembly protein TapA -
  R0492_RS13305 - 2560932..2561252 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  R0492_RS13310 - 2561282..2561464 (-) 183 WP_003183456.1 YqzE family protein -
  R0492_RS13315 comGG 2561553..2561918 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  R0492_RS13320 comGF 2561931..2562419 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  R0492_RS13325 comGE 2562328..2562675 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=892226 R0492_RS13280 WP_003183444.1 2557828..2558004(+) (sinI) [Bacillus licheniformis strain NXU98]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=892226 R0492_RS13280 WP_003183444.1 2557828..2558004(+) (sinI) [Bacillus licheniformis strain NXU98]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517