Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RX583_RS17240 Genome accession   NZ_CP136402
Coordinates   3258493..3258633 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3253493..3263633
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RX583_RS17215 (RX583_17215) yuxO 3253806..3254186 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  RX583_RS17220 (RX583_17220) comA 3254205..3254849 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  RX583_RS17225 (RX583_17225) comP 3254930..3257239 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  RX583_RS17230 (RX583_17230) comX 3257254..3257421 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  RX583_RS17235 (RX583_17235) comQ 3257409..3258308 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  RX583_RS17240 (RX583_17240) degQ 3258493..3258633 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  RX583_RS17245 (RX583_17245) - 3258855..3258980 (+) 126 WP_003228793.1 hypothetical protein -
  RX583_RS17250 (RX583_17250) - 3259094..3259462 (+) 369 WP_003243784.1 hypothetical protein -
  RX583_RS17255 (RX583_17255) pdeH 3259438..3260667 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  RX583_RS17260 (RX583_17260) pncB 3260804..3262276 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  RX583_RS17265 (RX583_17265) pncA 3262292..3262843 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  RX583_RS17270 (RX583_17270) yueI 3262940..3263338 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=890720 RX583_RS17240 WP_003220708.1 3258493..3258633(-) (degQ) [Bacillus subtilis subsp. subtilis str. 168]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=890720 RX583_RS17240 WP_003220708.1 3258493..3258633(-) (degQ) [Bacillus subtilis subsp. subtilis str. 168]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1