Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RUI02_RS16190 Genome accession   NZ_CP136099
Coordinates   3112804..3112944 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. TSA-4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3107804..3117944
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RUI02_RS16165 (RUI02_16165) - 3108081..3108461 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  RUI02_RS16170 (RUI02_16170) comA 3108480..3109124 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  RUI02_RS16175 (RUI02_16175) comP 3109205..3111517 (-) 2313 WP_041332996.1 sensor histidine kinase Regulator
  RUI02_RS16180 (RUI02_16180) comX 3111533..3111754 (-) 222 WP_014480704.1 competence pheromone ComX -
  RUI02_RS16185 (RUI02_16185) - 3111756..3112619 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  RUI02_RS16190 (RUI02_16190) degQ 3112804..3112944 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  RUI02_RS16195 (RUI02_16195) - 3113166..3113291 (+) 126 WP_003228793.1 hypothetical protein -
  RUI02_RS16200 (RUI02_16200) - 3113406..3113774 (+) 369 WP_046381300.1 hypothetical protein -
  RUI02_RS16205 (RUI02_16205) pdeH 3113750..3114979 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  RUI02_RS16210 (RUI02_16210) - 3115116..3116588 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  RUI02_RS16215 (RUI02_16215) - 3116604..3117155 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  RUI02_RS16220 (RUI02_16220) - 3117252..3117650 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=888436 RUI02_RS16190 WP_003220708.1 3112804..3112944(-) (degQ) [Bacillus sp. TSA-4]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=888436 RUI02_RS16190 WP_003220708.1 3112804..3112944(-) (degQ) [Bacillus sp. TSA-4]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1