Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RP314_RS04795 Genome accession   NZ_CP135199
Coordinates   936490..936630 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain CMML21-47     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 931490..941630
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RP314_RS04770 (RP314_04770) - 931797..932195 (+) 399 WP_003152031.1 YueI family protein -
  RP314_RS04775 (RP314_04775) - 932292..932843 (+) 552 WP_077722769.1 cysteine hydrolase family protein -
  RP314_RS04780 (RP314_04780) - 932861..934327 (+) 1467 WP_154066736.1 nicotinate phosphoribosyltransferase -
  RP314_RS04785 (RP314_04785) - 934457..935677 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  RP314_RS04790 (RP314_04790) - 935684..936025 (-) 342 WP_014305721.1 hypothetical protein -
  RP314_RS04795 (RP314_04795) degQ 936490..936630 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  RP314_RS04800 (RP314_04800) - 936782..937693 (+) 912 WP_031378407.1 polyprenyl synthetase family protein -
  RP314_RS04805 (RP314_04805) comX 937693..937857 (+) 165 WP_007613432.1 competence pheromone ComX -
  RP314_RS04810 (RP314_04810) comP 937869..940160 (+) 2292 WP_077722768.1 histidine kinase Regulator
  RP314_RS04815 (RP314_04815) comA 940241..940885 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  RP314_RS04820 (RP314_04820) - 940907..941290 (+) 384 WP_007613430.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=886185 RP314_RS04795 WP_003152043.1 936490..936630(+) (degQ) [Bacillus velezensis strain CMML21-47]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=886185 RP314_RS04795 WP_003152043.1 936490..936630(+) (degQ) [Bacillus velezensis strain CMML21-47]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891