Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   RPB93_RS14305 Genome accession   NZ_CP135060
Coordinates   2796906..2797184 (-) Length   92 a.a.
NCBI ID   WP_046392727.1    Uniprot ID   -
Organism   Bacillus cereus strain B126_1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2763679..2807719 2796906..2797184 within 0


Gene organization within MGE regions


Location: 2763679..2807719
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RPB93_RS14100 (RPB93_14100) - 2763679..2764395 (-) 717 WP_046392753.1 N-acetylmuramoyl-L-alanine amidase family protein -
  RPB93_RS14105 (RPB93_14105) - 2764395..2764820 (-) 426 WP_046392752.1 holin family protein -
  RPB93_RS14110 (RPB93_14110) - 2764855..2765235 (-) 381 WP_046392751.1 hypothetical protein -
  RPB93_RS14115 (RPB93_14115) - 2765247..2770346 (-) 5100 WP_046392750.1 phage tail spike protein -
  RPB93_RS14120 (RPB93_14120) - 2770343..2771800 (-) 1458 WP_046392749.1 distal tail protein Dit -
  RPB93_RS14125 (RPB93_14125) - 2771842..2774007 (-) 2166 WP_046392748.1 phage tail tape measure protein, TP901 family, core region -
  RPB93_RS14130 (RPB93_14130) - 2774231..2775688 (-) 1458 Protein_2792 DUF2207 domain-containing protein -
  RPB93_RS14135 (RPB93_14135) - 2775704..2775865 (-) 162 WP_044798004.1 hypothetical protein -
  RPB93_RS14140 (RPB93_14140) - 2775919..2776281 (-) 363 WP_046392746.1 hypothetical protein -
  RPB93_RS14145 (RPB93_14145) - 2776286..2776873 (-) 588 WP_046392745.1 major tail protein -
  RPB93_RS14150 (RPB93_14150) - 2776874..2777203 (-) 330 WP_046392744.1 hypothetical protein -
  RPB93_RS14155 (RPB93_14155) - 2777200..2777544 (-) 345 WP_025710295.1 HK97 gp10 family phage protein -
  RPB93_RS14160 (RPB93_14160) - 2777546..2777896 (-) 351 WP_023522880.1 phage head closure protein -
  RPB93_RS14165 (RPB93_14165) - 2777898..2778191 (-) 294 WP_016125626.1 hypothetical protein -
  RPB93_RS14170 (RPB93_14170) - 2778204..2779364 (-) 1161 WP_371404327.1 phage major capsid protein -
  RPB93_RS14175 (RPB93_14175) - 2779397..2780122 (-) 726 WP_000791073.1 head maturation protease, ClpP-related -
  RPB93_RS14180 (RPB93_14180) - 2780112..2781263 (-) 1152 WP_046392743.1 phage portal protein -
  RPB93_RS14185 (RPB93_14185) - 2781284..2782969 (-) 1686 WP_016125622.1 terminase large subunit domain-containing protein -
  RPB93_RS14190 (RPB93_14190) - 2782966..2783277 (-) 312 WP_016125621.1 P27 family phage terminase small subunit -
  RPB93_RS14195 (RPB93_14195) - 2783401..2783736 (-) 336 WP_046392742.1 HNH endonuclease -
  RPB93_RS14200 (RPB93_14200) - 2783729..2783959 (-) 231 WP_046392741.1 hypothetical protein -
  RPB93_RS14205 (RPB93_14205) - 2783964..2784278 (-) 315 WP_046392740.1 hypothetical protein -
  RPB93_RS14210 (RPB93_14210) - 2784275..2784526 (-) 252 WP_046392739.1 hypothetical protein -
  RPB93_RS14215 (RPB93_14215) - 2784540..2784719 (-) 180 WP_046392738.1 hypothetical protein -
  RPB93_RS14220 (RPB93_14220) - 2784763..2785515 (-) 753 WP_046392737.1 hypothetical protein -
  RPB93_RS14225 (RPB93_14225) - 2786059..2786760 (-) 702 WP_046392736.1 hypothetical protein -
  RPB93_RS14230 (RPB93_14230) - 2787155..2788105 (-) 951 WP_001170296.1 nucleoside hydrolase -
  RPB93_RS14235 (RPB93_14235) - 2788320..2788862 (-) 543 WP_046392735.1 site-specific integrase -
  RPB93_RS14240 (RPB93_14240) - 2788862..2789344 (-) 483 WP_046392734.1 ArpU family phage packaging/lysis transcriptional regulator -
  RPB93_RS14245 (RPB93_14245) - 2789372..2789542 (-) 171 WP_033695145.1 hypothetical protein -
  RPB93_RS14250 (RPB93_14250) - 2789647..2789778 (-) 132 WP_116344833.1 DUF3983 domain-containing protein -
  RPB93_RS14255 (RPB93_14255) - 2790065..2790349 (+) 285 WP_001123250.1 DUF4183 domain-containing protein -
  RPB93_RS14260 (RPB93_14260) - 2790760..2790999 (-) 240 WP_046392733.1 hypothetical protein -
  RPB93_RS14265 (RPB93_14265) - 2791806..2792273 (+) 468 WP_046392732.1 hypothetical protein -
  RPB93_RS14270 (RPB93_14270) - 2792470..2793039 (+) 570 WP_046392731.1 cupin domain-containing protein -
  RPB93_RS14275 (RPB93_14275) - 2793863..2794327 (+) 465 WP_046392730.1 hypothetical protein -
  RPB93_RS14280 (RPB93_14280) - 2794656..2795444 (+) 789 WP_046392729.1 sulfotransferase family 2 domain-containing protein -
  RPB93_RS14285 (RPB93_14285) - 2795589..2796071 (-) 483 WP_046392728.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  RPB93_RS14290 (RPB93_14290) - 2796091..2796342 (-) 252 WP_000109500.1 hypothetical protein -
  RPB93_RS14295 (RPB93_14295) - 2796368..2796535 (-) 168 WP_000717826.1 DUF3954 domain-containing protein -
  RPB93_RS14300 (RPB93_14300) - 2796554..2796913 (-) 360 WP_016512772.1 hypothetical protein -
  RPB93_RS14305 (RPB93_14305) abrB 2796906..2797184 (-) 279 WP_046392727.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  RPB93_RS14310 (RPB93_14310) - 2797188..2798243 (-) 1056 WP_046392726.1 DnaD domain-containing protein -
  RPB93_RS14315 (RPB93_14315) - 2798301..2798465 (-) 165 WP_046392725.1 hypothetical protein -
  RPB93_RS14320 (RPB93_14320) - 2798465..2798731 (-) 267 WP_000522030.1 helix-turn-helix domain-containing protein -
  RPB93_RS14325 (RPB93_14325) - 2798788..2798979 (-) 192 WP_046392724.1 helix-turn-helix domain-containing protein -
  RPB93_RS14330 (RPB93_14330) - 2799180..2799533 (+) 354 WP_016095531.1 helix-turn-helix domain-containing protein -
  RPB93_RS14335 (RPB93_14335) - 2799571..2799699 (-) 129 WP_000836783.1 hypothetical protein -
  RPB93_RS14340 (RPB93_14340) - 2799853..2799999 (-) 147 WP_046392723.1 hypothetical protein -
  RPB93_RS14345 (RPB93_14345) - 2800037..2801188 (-) 1152 WP_046392722.1 AimR family lysis-lysogeny pheromone receptor -
  RPB93_RS14350 (RPB93_14350) - 2801830..2803140 (-) 1311 WP_313755114.1 exosporium leader peptide-containing protein -
  RPB93_RS14355 (RPB93_14355) - 2803444..2804553 (+) 1110 WP_046392720.1 tyrosine-type recombinase/integrase -
  RPB93_RS14360 (RPB93_14360) - 2804622..2805293 (-) 672 WP_046392719.1 pPIWI_RE module domain-containing protein -
  RPB93_RS14365 (RPB93_14365) - 2805605..2806090 (-) 486 WP_002024190.1 hypothetical protein -
  RPB93_RS14370 (RPB93_14370) - 2806300..2806434 (-) 135 Protein_2840 site-specific integrase -
  RPB93_RS14375 (RPB93_14375) - 2806580..2806900 (-) 321 WP_001071364.1 heterocycloanthracin/sonorensin family bacteriocin -
  RPB93_RS14380 (RPB93_14380) - 2807456..2807719 (-) 264 WP_016122577.1 DUF3937 family protein -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10231.85 Da        Isoelectric Point: 6.2246

>NTDB_id=884627 RPB93_RS14305 WP_046392727.1 2796906..2797184(-) (abrB) [Bacillus cereus strain B126_1]
MKNTGVARKVDELGRVVIPVELRRTLGINEGTALDFHVDGENIVLRRHEKSCFVTGEVFENNIELLGGRMFLSKEGVIEL
LDLIQKSGMAHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=884627 RPB93_RS14305 WP_046392727.1 2796906..2797184(-) (abrB) [Bacillus cereus strain B126_1]
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
CATTAACGAAGGAACGGCACTAGATTTTCATGTCGATGGTGAAAACATCGTTTTAAGAAGACATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTTTGAAAACAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGTAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA

Domains

Predicted by InterproScan.

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-47)

AbrB C-terminal domain (AbrB_C)

(52-86)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.322

94.565

0.533