Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   RNI18_RS09175 Genome accession   NZ_CP134775
Coordinates   1861556..1861675 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain KB21     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 1856556..1866675
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RNI18_RS09150 (RNI18_09150) - 1856794..1857552 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  RNI18_RS09155 (RNI18_09155) - 1857546..1858493 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  RNI18_RS09160 (RNI18_09160) ceuB 1858483..1859436 (-) 954 WP_046559346.1 ABC transporter permease Machinery gene
  RNI18_RS09165 (RNI18_09165) - 1859851..1861215 (+) 1365 WP_060657805.1 aspartate kinase -
  RNI18_RS09170 (RNI18_09170) - 1861295..1861405 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  RNI18_RS09175 (RNI18_09175) phrC 1861556..1861675 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  RNI18_RS09180 (RNI18_09180) rapC 1861659..1862807 (-) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  RNI18_RS09185 (RNI18_09185) - 1862960..1864393 (-) 1434 WP_161625271.1 HAMP domain-containing sensor histidine kinase -
  RNI18_RS09190 (RNI18_09190) - 1864380..1865063 (-) 684 WP_003156341.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=883576 RNI18_RS09175 WP_003156334.1 1861556..1861675(-) (phrC) [Bacillus velezensis strain KB21]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=883576 RNI18_RS09175 WP_003156334.1 1861556..1861675(-) (phrC) [Bacillus velezensis strain KB21]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718