Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | RJY17_RS03145 | Genome accession | NZ_CP134692 |
| Coordinates | 578738..578911 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain B5 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 573738..583911
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RJY17_RS03130 (RJY17_03130) | gcvT | 574551..575651 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| RJY17_RS03135 (RJY17_03135) | - | 576075..577745 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| RJY17_RS03140 (RJY17_03140) | - | 577767..578561 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| RJY17_RS03145 (RJY17_03145) | sinI | 578738..578911 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| RJY17_RS03150 (RJY17_03150) | sinR | 578945..579280 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| RJY17_RS03155 (RJY17_03155) | tasA | 579328..580113 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| RJY17_RS03160 (RJY17_03160) | sipW | 580178..580762 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| RJY17_RS03165 (RJY17_03165) | tapA | 580734..581405 (-) | 672 | WP_015417813.1 | amyloid fiber anchoring/assembly protein TapA | - |
| RJY17_RS03170 (RJY17_03170) | - | 581664..581993 (+) | 330 | WP_094032245.1 | DUF3889 domain-containing protein | - |
| RJY17_RS03175 (RJY17_03175) | - | 582033..582212 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| RJY17_RS03180 (RJY17_03180) | comGG | 582269..582646 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| RJY17_RS03185 (RJY17_03185) | comGF | 582647..583147 (-) | 501 | WP_254922226.1 | competence type IV pilus minor pilin ComGF | - |
| RJY17_RS03190 (RJY17_03190) | comGE | 583056..583370 (-) | 315 | WP_094032244.1 | competence type IV pilus minor pilin ComGE | - |
| RJY17_RS03195 (RJY17_03195) | comGD | 583354..583791 (-) | 438 | WP_094032243.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=882854 RJY17_RS03145 WP_003153105.1 578738..578911(+) (sinI) [Bacillus velezensis strain B5]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=882854 RJY17_RS03145 WP_003153105.1 578738..578911(+) (sinI) [Bacillus velezensis strain B5]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |