Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   RJ558_RS00930 Genome accession   NZ_CP134397
Coordinates   197611..197724 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain ICDC15003s     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 192611..202724
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RJ558_RS00905 (RJ558_00905) - 192659..194884 (+) 2226 WP_310957714.1 ATP-dependent Clp protease ATP-binding subunit -
  RJ558_RS00910 (RJ558_00910) panD 194874..195224 (+) 351 WP_180662627.1 aspartate 1-decarboxylase -
  RJ558_RS00915 (RJ558_00915) - 195235..195528 (+) 294 WP_000347919.1 YbaB/EbfC family nucleoid-associated protein -
  RJ558_RS00920 (RJ558_00920) - 195528..196532 (+) 1005 WP_310957715.1 PDZ domain-containing protein -
  RJ558_RS00925 (RJ558_00925) comB6 196540..197595 (+) 1056 WP_310958088.1 P-type conjugative transfer protein TrbL Machinery gene
  RJ558_RS00930 (RJ558_00930) comB7 197611..197724 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  RJ558_RS00935 (RJ558_00935) comB8 197721..198464 (+) 744 WP_001208395.1 virB8 family protein Machinery gene
  RJ558_RS00940 (RJ558_00940) comB9 198464..199447 (+) 984 WP_180662630.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  RJ558_RS00945 (RJ558_00945) comB10 199440..200576 (+) 1137 WP_310957716.1 DNA type IV secretion system protein ComB10 Machinery gene
  RJ558_RS00950 (RJ558_00950) - 200646..202058 (+) 1413 WP_180662633.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=879947 RJ558_RS00930 WP_001217873.1 197611..197724(+) (comB7) [Helicobacter pylori strain ICDC15003s]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=879947 RJ558_RS00930 WP_001217873.1 197611..197724(+) (comB7) [Helicobacter pylori strain ICDC15003s]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1