Detailed information    

insolico Bioinformatically predicted

Overview

Name   HI0659   Type   Machinery gene
Locus tag   RIM63_RS03905 Genome accession   NZ_CP133952
Coordinates   821834..822130 (+) Length   98 a.a.
NCBI ID   WP_043040417.1    Uniprot ID   -
Organism   Streptococcus equi subsp. zooepidemicus strain HT321     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 813196..833318 821834..822130 within 0


Gene organization within MGE regions


Location: 813196..833318
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RIM63_RS03825 (RIM63_03825) - 813196..814359 (-) 1164 WP_165627235.1 site-specific integrase -
  RIM63_RS03830 (RIM63_03830) - 814437..815021 (-) 585 WP_207621811.1 helix-turn-helix domain-containing protein -
  RIM63_RS03835 (RIM63_03835) - 815208..815396 (+) 189 WP_138082939.1 DNA-binding protein -
  RIM63_RS03840 (RIM63_03840) - 815580..815996 (+) 417 WP_138082937.1 hypothetical protein -
  RIM63_RS03845 (RIM63_03845) - 816017..816268 (+) 252 WP_138082935.1 hypothetical protein -
  RIM63_RS03850 (RIM63_03850) - 816271..816462 (+) 192 WP_138082933.1 hypothetical protein -
  RIM63_RS03855 (RIM63_03855) - 816478..816744 (+) 267 WP_138082931.1 hypothetical protein -
  RIM63_RS03860 (RIM63_03860) - 816755..816913 (+) 159 WP_162841287.1 hypothetical protein -
  RIM63_RS03865 (RIM63_03865) - 817105..817953 (+) 849 WP_317584971.1 DnaD domain protein -
  RIM63_RS03870 (RIM63_03870) - 817969..818817 (+) 849 WP_138082925.1 ATP-binding protein -
  RIM63_RS03875 (RIM63_03875) - 818850..819044 (+) 195 WP_138082923.1 hypothetical protein -
  RIM63_RS03880 (RIM63_03880) - 819496..819678 (+) 183 WP_138082921.1 hypothetical protein -
  RIM63_RS03885 (RIM63_03885) - 819774..820352 (+) 579 WP_138082919.1 hypothetical protein -
  RIM63_RS03890 (RIM63_03890) - 820349..820636 (+) 288 WP_138082917.1 hypothetical protein -
  RIM63_RS03895 (RIM63_03895) - 820869..821279 (+) 411 WP_138082915.1 hypothetical protein -
  RIM63_RS03900 (RIM63_03900) - 821479..821844 (+) 366 WP_043040416.1 type II toxin-antitoxin system RelE/ParE family toxin -
  RIM63_RS03905 (RIM63_03905) HI0659 821834..822130 (+) 297 WP_043040417.1 helix-turn-helix domain-containing protein Machinery gene
  RIM63_RS03910 (RIM63_03910) - 822152..823357 (+) 1206 WP_138082913.1 hypothetical protein -
  RIM63_RS03915 (RIM63_03915) - 823364..823531 (+) 168 WP_165626014.1 hypothetical protein -
  RIM63_RS03920 (RIM63_03920) - 823974..824063 (+) 90 WP_111677961.1 type I toxin-antitoxin system Fst family toxin -
  RIM63_RS03930 (RIM63_03930) - 825012..825641 (+) 630 WP_317584978.1 HAD family hydrolase -
  RIM63_RS03935 (RIM63_03935) - 826101..828881 (+) 2781 WP_317584980.1 endonuclease/exonuclease/phosphatase family protein -
  RIM63_RS03940 (RIM63_03940) - 829675..830181 (+) 507 WP_317584982.1 QueT transporter family protein -
  RIM63_RS03945 (RIM63_03945) - 830326..831279 (+) 954 WP_012514856.1 IS30 family transposase -
  RIM63_RS03950 (RIM63_03950) ligA 831360..833318 (+) 1959 WP_317584984.1 NAD-dependent DNA ligase LigA -

Sequence

Protein


Download         Length: 98 a.a.        Molecular weight: 10740.40 Da        Isoelectric Point: 4.8898

>NTDB_id=877758 RIM63_RS03905 WP_043040417.1 821834..822130(+) (HI0659) [Streptococcus equi subsp. zooepidemicus strain HT321]
MKNNAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEELSGVSQPVIARMETGKTSPQLDTVLKVL
ASLGKTLAVVPIEGEQVS

Nucleotide


Download         Length: 297 bp        

>NTDB_id=877758 RIM63_RS03905 WP_043040417.1 821834..822130(+) (HI0659) [Streptococcus equi subsp. zooepidemicus strain HT321]
ATGAAAAATAATGCTATTGGTAGTAACTGGAAAGATGTAAGAGCTGAATTATTCAGCAAAGAAGAAATTTTGGAAAGTGA
TATGCGCGTGGCTATCATGAGCGAGCTTATCGAGGCTAGAAATGAAAAGGGCATTAGTCAGAAGAAGCTAGAGGAGCTTA
GCGGTGTTAGTCAGCCAGTTATCGCTAGAATGGAAACAGGAAAGACAAGCCCACAACTTGATACAGTATTAAAAGTGTTG
GCAAGTCTTGGTAAGACGTTGGCTGTTGTACCCATAGAGGGCGAACAGGTAAGCTAG

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(37-88)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  HI0659 Haemophilus influenzae Rd KW20

57.143

92.857

0.531