Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | WOC55_RS06170 | Genome accession | NZ_CP150727 |
| Coordinates | 1255462..1255773 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain TUM22750 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1250462..1260773
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC55_RS06135 (WOC55_06135) | gcvPA | 1250964..1252310 (-) | 1347 | WP_117200971.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| WOC55_RS06140 (WOC55_06140) | gcvT | 1252330..1253421 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WOC55_RS06145 (WOC55_06145) | - | 1253580..1254104 (-) | 525 | WP_001015121.1 | shikimate kinase | - |
| WOC55_RS06150 (WOC55_06150) | - | 1254094..1254240 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| WOC55_RS06155 (WOC55_06155) | comGF | 1254337..1254834 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| WOC55_RS06160 (WOC55_06160) | comGE | 1254752..1255051 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| WOC55_RS06165 (WOC55_06165) | comGD | 1255038..1255484 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| WOC55_RS06170 (WOC55_06170) | comGC | 1255462..1255773 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| WOC55_RS06175 (WOC55_06175) | comGB | 1255787..1256857 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| WOC55_RS06180 (WOC55_06180) | comGA | 1256829..1257803 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| WOC55_RS06185 (WOC55_06185) | - | 1257855..1258478 (-) | 624 | WP_001223010.1 | MBL fold metallo-hydrolase | - |
| WOC55_RS06190 (WOC55_06190) | - | 1258475..1258804 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| WOC55_RS06195 (WOC55_06195) | - | 1258804..1259790 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| WOC55_RS06200 (WOC55_06200) | - | 1259787..1259990 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=877456 WOC55_RS06170 WP_000472256.1 1255462..1255773(-) (comGC) [Staphylococcus aureus strain TUM22750]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=877456 WOC55_RS06170 WP_000472256.1 1255462..1255773(-) (comGC) [Staphylococcus aureus strain TUM22750]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |