Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   RFN60_RS12785 Genome accession   NZ_CP133653
Coordinates   2492375..2492785 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain CP38     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2487741..2539234 2492375..2492785 within 0


Gene organization within MGE regions


Location: 2487741..2539234
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RFN60_RS12760 (RFN60_12760) yqeF 2487908..2488639 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  RFN60_RS12765 (RFN60_12765) cwlH 2488891..2489643 (-) 753 WP_015251672.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  RFN60_RS12770 (RFN60_12770) yqeD 2489830..2490456 (+) 627 WP_015251671.1 TVP38/TMEM64 family protein -
  RFN60_RS12775 (RFN60_12775) gnd 2490475..2491368 (-) 894 WP_015251670.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  RFN60_RS12780 (RFN60_12780) yqeB 2491620..2492342 (+) 723 WP_010886572.1 hypothetical protein -
  RFN60_RS12785 (RFN60_12785) nucA/comI 2492375..2492785 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  RFN60_RS12790 (RFN60_12790) - 2492981..2493331 (+) 351 Protein_2473 sigma-70 family RNA polymerase sigma factor -
  RFN60_RS12795 (RFN60_12795) spoIVCA 2493359..2494819 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  RFN60_RS12800 (RFN60_12800) - 2494777..2494955 (-) 179 Protein_2475 hypothetical protein -
  RFN60_RS12805 (RFN60_12805) arsC 2495310..2495729 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  RFN60_RS12810 (RFN60_12810) acr3 2495741..2496781 (-) 1041 WP_032722149.1 arsenite efflux transporter Acr3 -
  RFN60_RS12815 (RFN60_12815) arsK 2496804..2497244 (-) 441 WP_032722151.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  RFN60_RS12820 (RFN60_12820) arsR 2497303..2497620 (-) 318 WP_029318103.1 arsenical resistance operon transcriptional regulator ArsR -
  RFN60_RS12825 (RFN60_12825) yqcI 2497992..2498756 (-) 765 WP_017696291.1 YqcI/YcgG family protein -
  RFN60_RS12830 (RFN60_12830) rapE 2499199..2500326 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  RFN60_RS12835 (RFN60_12835) phrE 2500316..2500450 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  RFN60_RS12840 (RFN60_12840) - 2500560..2500718 (+) 159 WP_003245945.1 hypothetical protein -
  RFN60_RS12845 (RFN60_12845) yqcG 2501088..2502683 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  RFN60_RS12850 (RFN60_12850) yqcF 2502698..2503276 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  RFN60_RS12855 (RFN60_12855) - 2503394..2503540 (+) 147 WP_009967791.1 hypothetical protein -
  RFN60_RS12860 (RFN60_12860) - 2503537..2503899 (-) 363 WP_003229947.1 hypothetical protein -
  RFN60_RS12865 (RFN60_12865) - 2503915..2504394 (-) 480 WP_004399085.1 hypothetical protein -
  RFN60_RS12870 (RFN60_12870) cwlA 2504559..2505377 (-) 819 WP_017697459.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  RFN60_RS12875 (RFN60_12875) skhD 2505422..2505844 (-) 423 WP_017697460.1 holin family protein -
  RFN60_RS12880 (RFN60_12880) xepAK 2505890..2506783 (-) 894 WP_032722160.1 hypothetical protein -
  RFN60_RS12885 (RFN60_12885) yqcE 2506871..2507035 (-) 165 WP_003229944.1 XkdX family protein -
  RFN60_RS12890 (RFN60_12890) yqcD 2507032..2507367 (-) 336 WP_009967793.1 XkdW family protein -
  RFN60_RS12895 (RFN60_12895) yqcC 2507377..2508477 (-) 1101 WP_032722161.1 pyocin knob domain-containing protein -
  RFN60_RS12900 (RFN60_12900) - 2508481..2508753 (-) 273 WP_032722163.1 hypothetical protein -
  RFN60_RS12905 (RFN60_12905) yqcA 2508750..2509328 (-) 579 WP_032722164.1 YmfQ family protein -
  RFN60_RS12910 (RFN60_12910) yqbT 2509312..2510358 (-) 1047 WP_032722165.1 baseplate J/gp47 family protein -
  RFN60_RS12915 (RFN60_12915) yqbS 2510351..2510776 (-) 426 WP_032722166.1 DUF2634 domain-containing protein -
  RFN60_RS12920 (RFN60_12920) yqbR 2510789..2511055 (-) 267 WP_032722167.1 DUF2577 family protein -
  RFN60_RS12925 (RFN60_12925) yqbQ 2511052..2512032 (-) 981 WP_032722168.1 hypothetical protein -
  RFN60_RS12930 (RFN60_12930) yqbP 2512045..2512704 (-) 660 WP_032722169.1 LysM peptidoglycan-binding domain-containing protein -
  RFN60_RS12935 (RFN60_12935) yqbO 2512697..2517454 (-) 4758 WP_043940167.1 phage tail tape measure protein -
  RFN60_RS12940 (RFN60_12940) - 2517457..2517594 (-) 138 WP_021480099.1 hypothetical protein -
  RFN60_RS12945 (RFN60_12945) - 2517636..2518085 (-) 450 WP_032722171.1 phage tail assembly chaperone -
  RFN60_RS12950 (RFN60_12950) txpA 2518231..2518410 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  RFN60_RS12955 (RFN60_12955) bsrH 2518790..2518879 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  RFN60_RS12960 (RFN60_12960) yqbM 2519133..2519576 (-) 444 WP_003229930.1 phage tail tube protein -
  RFN60_RS12965 (RFN60_12965) yqbK 2519579..2520979 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  RFN60_RS12970 (RFN60_12970) - 2520980..2521171 (-) 192 WP_010886574.1 hypothetical protein -
  RFN60_RS12975 (RFN60_12975) yqbJ 2521168..2521605 (-) 438 WP_003229927.1 DUF6838 family protein -
  RFN60_RS12980 (RFN60_12980) yqbI 2521618..2522121 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  RFN60_RS12985 (RFN60_12985) yqbH 2522118..2522480 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  RFN60_RS12990 (RFN60_12990) gkpG 2522477..2522872 (-) 396 WP_004398566.1 DUF3199 family protein -
  RFN60_RS12995 (RFN60_12995) yqbF 2522876..2523187 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  RFN60_RS13000 (RFN60_13000) skdG 2523198..2524133 (-) 936 WP_309520476.1 phage major capsid protein -
  RFN60_RS13005 (RFN60_13005) yqbD 2524152..2525120 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  RFN60_RS13010 (RFN60_13010) - 2525153..2525806 (-) 654 WP_003229920.1 hypothetical protein -
  RFN60_RS13015 (RFN60_13015) yqbB 2525847..2526764 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  RFN60_RS13020 (RFN60_13020) yqbA 2526761..2528293 (-) 1533 WP_004398894.1 phage portal protein -
  RFN60_RS13025 (RFN60_13025) stmB 2528297..2529592 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  RFN60_RS13030 (RFN60_13030) terS 2529585..2530304 (-) 720 WP_003229916.1 phage terminase small subunit -
  RFN60_RS13035 (RFN60_13035) - 2530372..2530836 (-) 465 WP_004398685.1 hypothetical protein -
  RFN60_RS13040 (RFN60_13040) yqaQ 2530980..2531435 (-) 456 WP_004398775.1 hypothetical protein -
  RFN60_RS13045 (RFN60_13045) - 2531633..2532562 (+) 930 WP_003229913.1 hypothetical protein -
  RFN60_RS13050 (RFN60_13050) yqaO 2532636..2532842 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  RFN60_RS13055 (RFN60_13055) yqaN 2532924..2533352 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  RFN60_RS13060 (RFN60_13060) - 2533448..2533597 (-) 150 WP_003229910.1 hypothetical protein -
  RFN60_RS13065 (RFN60_13065) sknM 2533588..2534529 (-) 942 WP_075058863.1 ATP-binding protein -
  RFN60_RS13070 (RFN60_13070) yqaL 2534411..2535088 (-) 678 WP_116362964.1 DnaD domain-containing protein -
  RFN60_RS13075 (RFN60_13075) recT 2535164..2536018 (-) 855 WP_003229907.1 recombinase RecT -
  RFN60_RS13080 (RFN60_13080) yqaJ 2536021..2536980 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  RFN60_RS13085 (RFN60_13085) - 2537086..2537280 (-) 195 WP_003229905.1 YqaI family protein -
  RFN60_RS13090 (RFN60_13090) - 2537240..2537413 (-) 174 WP_119123069.1 hypothetical protein -
  RFN60_RS13095 (RFN60_13095) sknH 2537410..2537667 (-) 258 WP_003245994.1 YqaH family protein -
  RFN60_RS13100 (RFN60_13100) yqaG 2537664..2538233 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  RFN60_RS13105 (RFN60_13105) - 2538307..2538447 (-) 141 WP_003229902.1 hypothetical protein -
  RFN60_RS13110 (RFN60_13110) yqaF 2538477..2538707 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  RFN60_RS13115 (RFN60_13115) sknR 2538884..2539234 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=875586 RFN60_RS12785 WP_009967785.1 2492375..2492785(-) (nucA/comI) [Bacillus subtilis strain CP38]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=875586 RFN60_RS12785 WP_009967785.1 2492375..2492785(-) (nucA/comI) [Bacillus subtilis strain CP38]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCTGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGCTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGAGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTACGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529