Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | RCF60_RS14755 | Genome accession | NZ_CP133320 |
| Coordinates | 2998359..2998499 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain 1X1Y | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2993359..3003499
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RCF60_RS14730 (RCF60_14725) | - | 2993705..2994088 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| RCF60_RS14735 (RCF60_14730) | comA | 2994110..2994754 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| RCF60_RS14740 (RCF60_14735) | comP | 2994835..2997135 (-) | 2301 | WP_032876801.1 | histidine kinase | Regulator |
| RCF60_RS14745 (RCF60_14740) | comX | 2997149..2997322 (-) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| RCF60_RS14750 (RCF60_14745) | - | 2997291..2998151 (-) | 861 | WP_142925231.1 | polyprenyl synthetase family protein | - |
| RCF60_RS14755 (RCF60_14750) | degQ | 2998359..2998499 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| RCF60_RS14760 (RCF60_14755) | - | 2998965..2999306 (+) | 342 | WP_032876795.1 | hypothetical protein | - |
| RCF60_RS14765 (RCF60_14760) | - | 2999313..3000536 (-) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| RCF60_RS14770 (RCF60_14765) | - | 3000666..3002132 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| RCF60_RS14775 (RCF60_14770) | - | 3002150..3002701 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| RCF60_RS14780 (RCF60_14775) | - | 3002798..3003196 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=873453 RCF60_RS14755 WP_003152043.1 2998359..2998499(-) (degQ) [Bacillus velezensis strain 1X1Y]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=873453 RCF60_RS14755 WP_003152043.1 2998359..2998499(-) (degQ) [Bacillus velezensis strain 1X1Y]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |