Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   K6J86_RS13710 Genome accession   NZ_AP024627
Coordinates   2624600..2625010 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain BEST3136     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2625206..2675317 2624600..2625010 flank 196


Gene organization within MGE regions


Location: 2624600..2675317
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6J86_RS13710 (BsBEST3136_26460) nucA/comI 2624600..2625010 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  K6J86_RS13715 (BsBEST3136_26470) - 2625206..2625556 (+) 351 Protein_2664 sigma-70 family RNA polymerase sigma factor -
  K6J86_RS13720 (BsBEST3136_26480) spoIVCA 2625584..2627044 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  K6J86_RS21945 (BsBEST3136_26490) - 2627002..2627180 (-) 179 Protein_2666 hypothetical protein -
  K6J86_RS13725 (BsBEST3136_26500) arsC 2627535..2627954 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  K6J86_RS13730 (BsBEST3136_26510) acr3 2627966..2629006 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  K6J86_RS13735 (BsBEST3136_26520) arsK 2629029..2629469 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  K6J86_RS13740 (BsBEST3136_26530) arsR 2629530..2629847 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  K6J86_RS13745 (BsBEST3136_26540) yqcI 2630219..2630983 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  K6J86_RS13750 (BsBEST3136_26550) rapE 2631426..2632553 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  K6J86_RS13755 (BsBEST3136_26560) phrE 2632543..2632677 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  K6J86_RS13760 (BsBEST3136_26570) - 2632787..2632945 (+) 159 WP_003245945.1 hypothetical protein -
  K6J86_RS13765 (BsBEST3136_26580) yqcG 2633315..2634910 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  K6J86_RS13770 (BsBEST3136_26590) yqcF 2634925..2635503 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  K6J86_RS13775 (BsBEST3136_26600) - 2635621..2635767 (+) 147 WP_009967791.1 hypothetical protein -
  K6J86_RS13780 (BsBEST3136_26610) - 2635764..2636126 (-) 363 WP_003229947.1 hypothetical protein -
  K6J86_RS13785 (BsBEST3136_26620) - 2636142..2636621 (-) 480 WP_004399085.1 hypothetical protein -
  K6J86_RS13790 (BsBEST3136_26630) cwlA 2636786..2637604 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  K6J86_RS13795 (BsBEST3136_26640) skhD 2637649..2638071 (-) 423 WP_003246208.1 holin family protein -
  K6J86_RS13800 (BsBEST3136_26650) xepAK 2638116..2639009 (-) 894 WP_003246010.1 hypothetical protein -
  K6J86_RS13805 (BsBEST3136_26660) yqcE 2639097..2639261 (-) 165 WP_003229944.1 XkdX family protein -
  K6J86_RS13810 (BsBEST3136_26670) yqcD 2639258..2639593 (-) 336 WP_009967793.1 XkdW family protein -
  K6J86_RS13815 (BsBEST3136_26680) yqcC 2639603..2640703 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  K6J86_RS13820 (BsBEST3136_26690) - 2640706..2640978 (-) 273 WP_003229942.1 hypothetical protein -
  K6J86_RS13825 (BsBEST3136_26700) yqcA 2640975..2641553 (-) 579 WP_003229941.1 YmfQ family protein -
  K6J86_RS13830 (BsBEST3136_26710) yqbT 2641537..2642583 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  K6J86_RS13835 (BsBEST3136_26720) yqbS 2642576..2643001 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  K6J86_RS13840 (BsBEST3136_26730) yqbR 2643014..2643277 (-) 264 WP_003229938.1 DUF2577 family protein -
  K6J86_RS13845 (BsBEST3136_26740) yqbQ 2643274..2644254 (-) 981 WP_004398524.1 hypothetical protein -
  K6J86_RS13850 (BsBEST3136_26750) yqbP 2644267..2644926 (-) 660 WP_004398548.1 LysM peptidoglycan-binding domain-containing protein -
  K6J86_RS13855 (BsBEST3136_26760) yqbO 2644919..2649676 (-) 4758 WP_003246092.1 phage tail tape measure protein -
  K6J86_RS13860 (BsBEST3136_26770) - 2649679..2649816 (-) 138 WP_003229934.1 hypothetical protein -
  K6J86_RS13865 (BsBEST3136_26780) - 2649858..2650307 (-) 450 WP_003229933.1 phage tail assembly chaperone -
  K6J86_RS13870 (BsBEST3136_26790) txpA 2650453..2650632 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  K6J86_RS13875 bsrH 2651012..2651101 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  K6J86_RS13880 (BsBEST3136_26810) yqbM 2651355..2651798 (-) 444 WP_003229930.1 phage tail tube protein -
  K6J86_RS13885 (BsBEST3136_26820) yqbK 2651801..2653201 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  K6J86_RS13890 (BsBEST3136_26830) - 2653202..2653393 (-) 192 WP_010886574.1 hypothetical protein -
  K6J86_RS13895 (BsBEST3136_26840) yqbJ 2653390..2653827 (-) 438 WP_003229927.1 DUF6838 family protein -
  K6J86_RS13900 (BsBEST3136_26850) yqbI 2653840..2654343 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  K6J86_RS13905 (BsBEST3136_26860) yqbH 2654340..2654702 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  K6J86_RS13910 (BsBEST3136_26870) gkpG 2654699..2655094 (-) 396 WP_004398566.1 DUF3199 family protein -
  K6J86_RS13915 (BsBEST3136_26880) yqbF 2655098..2655409 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  K6J86_RS13920 (BsBEST3136_26890) skdG 2655420..2656355 (-) 936 WP_003229922.1 phage major capsid protein -
  K6J86_RS13925 (BsBEST3136_26900) yqbD 2656374..2657342 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  K6J86_RS13930 (BsBEST3136_26910) - 2657375..2658028 (-) 654 WP_003229920.1 hypothetical protein -
  K6J86_RS13935 (BsBEST3136_26920) yqbB 2658069..2658986 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  K6J86_RS13940 (BsBEST3136_26930) yqbA 2658983..2660515 (-) 1533 WP_004398894.1 phage portal protein -
  K6J86_RS13945 (BsBEST3136_26940) stmB 2660519..2661814 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  K6J86_RS13950 (BsBEST3136_26950) terS 2661807..2662526 (-) 720 WP_003229916.1 phage terminase small subunit -
  K6J86_RS13955 (BsBEST3136_26960) - 2662594..2663058 (-) 465 WP_004398685.1 hypothetical protein -
  K6J86_RS13960 (BsBEST3136_26970) yqaQ 2663202..2663657 (-) 456 WP_004398775.1 hypothetical protein -
  K6J86_RS13965 (BsBEST3136_26980) - 2663855..2664784 (+) 930 WP_003229913.1 hypothetical protein -
  K6J86_RS13970 (BsBEST3136_26990) yqaO 2664858..2665064 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  K6J86_RS13975 (BsBEST3136_27000) yqaN 2665146..2665574 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  K6J86_RS13980 (BsBEST3136_27010) - 2665670..2665819 (-) 150 WP_003229910.1 hypothetical protein -
  K6J86_RS13985 (BsBEST3136_27020) sknM 2665810..2666751 (-) 942 WP_075058863.1 ATP-binding protein -
  K6J86_RS13990 (BsBEST3136_27030) yqaL 2666633..2667310 (-) 678 WP_010886575.1 DnaD domain-containing protein -
  K6J86_RS13995 (BsBEST3136_27040) recT 2667386..2668240 (-) 855 WP_003229907.1 recombinase RecT -
  K6J86_RS14000 (BsBEST3136_27050) yqaJ 2668243..2669202 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  K6J86_RS14005 (BsBEST3136_27060) - 2669308..2669502 (-) 195 WP_003229905.1 YqaI family protein -
  K6J86_RS14010 (BsBEST3136_27070) - 2669462..2669635 (-) 174 WP_119123069.1 hypothetical protein -
  K6J86_RS14015 (BsBEST3136_27080) sknH 2669632..2669889 (-) 258 WP_003245994.1 YqaH family protein -
  K6J86_RS14020 (BsBEST3136_27090) yqaG 2669886..2670455 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  K6J86_RS14025 (BsBEST3136_27100) - 2670529..2670669 (-) 141 WP_003229902.1 hypothetical protein -
  K6J86_RS14030 (BsBEST3136_27110) yqaF 2670699..2670929 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  K6J86_RS14035 (BsBEST3136_27120) sknR 2671106..2671456 (+) 351 WP_004398704.1 transcriptional regulator SknR -
  K6J86_RS14040 (BsBEST3136_27130) - 2671723..2671890 (-) 168 WP_003229900.1 hypothetical protein -
  K6J86_RS14045 (BsBEST3136_27140) yqaC 2672246..2672782 (-) 537 WP_004399117.1 AAA family ATPase -
  K6J86_RS14050 (BsBEST3136_27150) yqaB 2673051..2673569 (+) 519 WP_004399097.1 ImmA/IrrE family metallo-endopeptidase -
  K6J86_RS14055 (BsBEST3136_27160) - 2673569..2673967 (+) 399 Protein_2733 sigma-70 family RNA polymerase sigma factor -
  K6J86_RS14060 - 2673967..2674083 (+) 117 WP_003229898.1 hypothetical protein -
  K6J86_RS14065 - 2674049..2674249 (-) 201 Protein_2735 recombinase family protein -
  K6J86_RS14070 - 2674192..2674356 (-) 165 WP_010886576.1 hypothetical protein -
  K6J86_RS14075 (BsBEST3136_27170) psiE 2674901..2675317 (-) 417 WP_003246154.1 phosphate-starvation-inducible protein PsiE -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=87302 K6J86_RS13710 WP_009967785.1 2624600..2625010(-) (nucA/comI) [Bacillus subtilis strain BEST3136]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=87302 K6J86_RS13710 WP_009967785.1 2624600..2625010(-) (nucA/comI) [Bacillus subtilis strain BEST3136]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529

Multiple sequence alignment