Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   K6K02_RS16945 Genome accession   NZ_AP024626
Coordinates   3224614..3224754 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BEST3125     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3219614..3229754
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6K02_RS16920 (BsBEST3125_32450) yuxO 3219891..3220271 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  K6K02_RS16925 (BsBEST3125_32460) comA 3220290..3220934 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  K6K02_RS16930 (BsBEST3125_32470) comP 3221015..3223327 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  K6K02_RS16935 (BsBEST3125_32480) comX 3223343..3223564 (-) 222 WP_014480704.1 competence pheromone ComX -
  K6K02_RS16940 (BsBEST3125_32490) - 3223566..3224429 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  K6K02_RS16945 (BsBEST3125_32500) degQ 3224614..3224754 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  K6K02_RS16950 - 3224976..3225101 (+) 126 WP_003228793.1 hypothetical protein -
  K6K02_RS16955 (BsBEST3125_32510) - 3225215..3225583 (+) 369 WP_014477834.1 hypothetical protein -
  K6K02_RS16960 (BsBEST3125_32520) pdeH 3225559..3226788 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  K6K02_RS16965 (BsBEST3125_32530) pncB 3226924..3228396 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  K6K02_RS16970 (BsBEST3125_32540) pncA 3228412..3228963 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  K6K02_RS16975 (BsBEST3125_32550) yueI 3229060..3229458 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=87230 K6K02_RS16945 WP_003220708.1 3224614..3224754(-) (degQ) [Bacillus subtilis strain BEST3125]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=87230 K6K02_RS16945 WP_003220708.1 3224614..3224754(-) (degQ) [Bacillus subtilis strain BEST3125]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment