Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   RBH91_RS14165 Genome accession   NZ_CP133085
Coordinates   2883494..2883670 (+) Length   58 a.a.
NCBI ID   WP_076761843.1    Uniprot ID   A0A1R1QAK4
Organism   Bacillus swezeyi strain EA208     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2878494..2888670
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RBH91_RS14150 gcvT 2879132..2880226 (-) 1095 WP_076761840.1 glycine cleavage system aminomethyltransferase GcvT -
  RBH91_RS14155 - 2880825..2882504 (+) 1680 WP_307891989.1 SNF2-related protein -
  RBH91_RS14160 - 2882508..2883302 (+) 795 WP_307891990.1 YqhG family protein -
  RBH91_RS14165 sinI 2883494..2883670 (+) 177 WP_076761843.1 anti-repressor SinI Regulator
  RBH91_RS14170 sinR 2883704..2884039 (+) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  RBH91_RS14175 tasA 2884152..2884946 (-) 795 WP_076761844.1 biofilm matrix protein TasA -
  RBH91_RS14180 sipW 2885017..2885601 (-) 585 WP_076761845.1 signal peptidase I SipW -
  RBH91_RS14185 tapA 2885598..2886338 (-) 741 WP_307891991.1 amyloid fiber anchoring/assembly protein TapA -
  RBH91_RS14190 - 2886608..2886928 (+) 321 WP_076761847.1 DUF3889 domain-containing protein -
  RBH91_RS14195 - 2887232..2887414 (-) 183 WP_076761848.1 YqzE family protein -
  RBH91_RS14200 comGG 2887497..2887865 (-) 369 WP_307891992.1 competence type IV pilus minor pilin ComGG -
  RBH91_RS14205 comGF 2887877..2888368 (-) 492 WP_307891993.1 competence type IV pilus minor pilin ComGF -
  RBH91_RS14210 comGE 2888277..2888624 (-) 348 WP_076761851.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6693.50 Da        Isoelectric Point: 5.0931

>NTDB_id=871742 RBH91_RS14165 WP_076761843.1 2883494..2883670(+) (sinI) [Bacillus swezeyi strain EA208]
MNKDKNEKEELDEEWAELIKNALKEGISPDEIRFFLNLGKKSSKASTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=871742 RBH91_RS14165 WP_076761843.1 2883494..2883670(+) (sinI) [Bacillus swezeyi strain EA208]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAAGAGTGGGCTGAGCTGATAAAAAACGCCCTGAAGGAAGGTAT
TAGTCCAGATGAAATACGATTTTTTCTCAATTTAGGAAAGAAGTCTTCCAAAGCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1R1QAK4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

48.276

100

0.483