Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   K6J91_RS16960 Genome accession   NZ_AP024624
Coordinates   3221674..3221841 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain BEST3106     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3216674..3226841
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6J91_RS16930 (BsBEST3106_32420) mrpE 3217069..3217545 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  K6J91_RS16935 (BsBEST3106_32430) mrpF 3217545..3217829 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  K6J91_RS16940 (BsBEST3106_32440) mnhG 3217813..3218187 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  K6J91_RS16945 (BsBEST3106_32450) yuxO 3218226..3218606 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  K6J91_RS16950 (BsBEST3106_32460) comA 3218625..3219269 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  K6J91_RS16955 comP 3219350..3221659 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  K6J91_RS16960 (BsBEST3106_32490) comX 3221674..3221841 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  K6J91_RS16965 (BsBEST3106_32500) comQ 3221829..3222728 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  K6J91_RS16970 (BsBEST3106_32510) degQ 3222913..3223053 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  K6J91_RS16975 - 3223275..3223400 (+) 126 WP_003228793.1 hypothetical protein -
  K6J91_RS16980 (BsBEST3106_32520) - 3223514..3223882 (+) 369 WP_003243784.1 hypothetical protein -
  K6J91_RS16985 (BsBEST3106_32530) pdeH 3223858..3225087 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  K6J91_RS16990 (BsBEST3106_32540) pncB 3225224..3226696 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=87058 K6J91_RS16960 WP_003242801.1 3221674..3221841(-) (comX) [Bacillus subtilis strain BEST3106]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=87058 K6J91_RS16960 WP_003242801.1 3221674..3221841(-) (comX) [Bacillus subtilis strain BEST3106]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment