Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   K6J99_RS13710 Genome accession   NZ_AP024623
Coordinates   2620986..2621396 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain BEST3102     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2616352..2667842 2620986..2621396 within 0


Gene organization within MGE regions


Location: 2616352..2667842
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6J99_RS13685 (BsBEST3102_26200) yqeF 2616519..2617250 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  K6J99_RS13690 (BsBEST3102_26210) cwlH 2617502..2618254 (-) 753 WP_003229963.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  K6J99_RS13695 (BsBEST3102_26220) yqeD 2618441..2619067 (+) 627 WP_003229962.1 TVP38/TMEM64 family protein -
  K6J99_RS13700 (BsBEST3102_26230) gnd 2619086..2619979 (-) 894 WP_003229961.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  K6J99_RS13705 (BsBEST3102_26240) yqeB 2620231..2620953 (+) 723 WP_010886572.1 hypothetical protein -
  K6J99_RS13710 (BsBEST3102_26250) nucA/comI 2620986..2621396 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  K6J99_RS13715 (BsBEST3102_26260) - 2621592..2621942 (+) 351 Protein_2664 sigma-70 family RNA polymerase sigma factor -
  K6J99_RS13720 (BsBEST3102_26270) spoIVCA 2621970..2623430 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  K6J99_RS21980 (BsBEST3102_26280) - 2623388..2623566 (-) 179 Protein_2666 hypothetical protein -
  K6J99_RS13725 (BsBEST3102_26290) arsC 2623921..2624340 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  K6J99_RS13730 (BsBEST3102_26300) acr3 2624352..2625392 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  K6J99_RS13735 (BsBEST3102_26310) arsK 2625415..2625855 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  K6J99_RS13740 (BsBEST3102_26320) arsR 2625916..2626233 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  K6J99_RS13745 (BsBEST3102_26330) yqcI 2626605..2627369 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  K6J99_RS13750 (BsBEST3102_26340) rapE 2627812..2628939 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  K6J99_RS13755 (BsBEST3102_26350) phrE 2628929..2629063 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  K6J99_RS13760 (BsBEST3102_26360) - 2629173..2629331 (+) 159 WP_003245945.1 hypothetical protein -
  K6J99_RS13765 (BsBEST3102_26370) yqcG 2629701..2631296 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  K6J99_RS13770 (BsBEST3102_26380) yqcF 2631311..2631889 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  K6J99_RS13775 (BsBEST3102_26390) - 2632007..2632153 (+) 147 WP_009967791.1 hypothetical protein -
  K6J99_RS13780 (BsBEST3102_26400) - 2632150..2632512 (-) 363 WP_003229947.1 hypothetical protein -
  K6J99_RS13785 (BsBEST3102_26410) - 2632528..2633007 (-) 480 WP_004399085.1 hypothetical protein -
  K6J99_RS13790 (BsBEST3102_26420) cwlA 2633172..2633990 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  K6J99_RS13795 (BsBEST3102_26430) skhD 2634035..2634457 (-) 423 WP_003246208.1 holin family protein -
  K6J99_RS13800 (BsBEST3102_26440) xepAK 2634502..2635395 (-) 894 WP_003246010.1 hypothetical protein -
  K6J99_RS13805 (BsBEST3102_26450) yqcE 2635483..2635647 (-) 165 WP_003229944.1 XkdX family protein -
  K6J99_RS13810 (BsBEST3102_26460) yqcD 2635644..2635979 (-) 336 WP_009967793.1 XkdW family protein -
  K6J99_RS13815 (BsBEST3102_26470) yqcC 2635989..2637089 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  K6J99_RS13820 (BsBEST3102_26480) - 2637092..2637364 (-) 273 WP_003229942.1 hypothetical protein -
  K6J99_RS13825 (BsBEST3102_26490) yqcA 2637361..2637939 (-) 579 WP_003229941.1 YmfQ family protein -
  K6J99_RS13830 (BsBEST3102_26500) yqbT 2637923..2638969 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  K6J99_RS13835 (BsBEST3102_26510) yqbS 2638962..2639387 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  K6J99_RS13840 (BsBEST3102_26520) yqbR 2639400..2639663 (-) 264 WP_003229938.1 DUF2577 family protein -
  K6J99_RS13845 (BsBEST3102_26530) yqbQ 2639660..2640640 (-) 981 WP_004398524.1 hypothetical protein -
  K6J99_RS13850 (BsBEST3102_26540) yqbP 2640653..2641312 (-) 660 WP_004398548.1 LysM peptidoglycan-binding domain-containing protein -
  K6J99_RS13855 (BsBEST3102_26550) yqbO 2641305..2646062 (-) 4758 WP_003246092.1 phage tail tape measure protein -
  K6J99_RS13860 (BsBEST3102_26560) - 2646065..2646202 (-) 138 WP_003229934.1 hypothetical protein -
  K6J99_RS13865 (BsBEST3102_26570) - 2646244..2646693 (-) 450 WP_003229933.1 phage tail assembly chaperone -
  K6J99_RS13870 (BsBEST3102_26580) txpA 2646839..2647018 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  K6J99_RS13875 bsrH 2647398..2647487 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  K6J99_RS13880 (BsBEST3102_26600) yqbM 2647741..2648184 (-) 444 WP_003229930.1 phage tail tube protein -
  K6J99_RS13885 (BsBEST3102_26610) yqbK 2648187..2649587 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  K6J99_RS13890 (BsBEST3102_26620) - 2649588..2649779 (-) 192 WP_010886574.1 hypothetical protein -
  K6J99_RS13895 (BsBEST3102_26630) yqbJ 2649776..2650213 (-) 438 WP_003229927.1 DUF6838 family protein -
  K6J99_RS13900 (BsBEST3102_26640) yqbI 2650226..2650729 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  K6J99_RS13905 (BsBEST3102_26650) yqbH 2650726..2651088 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  K6J99_RS13910 (BsBEST3102_26660) gkpG 2651085..2651480 (-) 396 WP_004398566.1 DUF3199 family protein -
  K6J99_RS13915 (BsBEST3102_26670) yqbF 2651484..2651795 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  K6J99_RS13920 (BsBEST3102_26680) skdG 2651806..2652741 (-) 936 WP_003229922.1 phage major capsid protein -
  K6J99_RS13925 (BsBEST3102_26690) yqbD 2652760..2653728 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  K6J99_RS13930 (BsBEST3102_26700) - 2653761..2654414 (-) 654 WP_003229920.1 hypothetical protein -
  K6J99_RS13935 (BsBEST3102_26710) yqbB 2654455..2655372 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  K6J99_RS13940 (BsBEST3102_26720) yqbA 2655369..2656901 (-) 1533 WP_004398894.1 phage portal protein -
  K6J99_RS13945 (BsBEST3102_26730) stmB 2656905..2658200 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  K6J99_RS13950 (BsBEST3102_26740) terS 2658193..2658912 (-) 720 WP_003229916.1 phage terminase small subunit -
  K6J99_RS13955 (BsBEST3102_26750) - 2658980..2659444 (-) 465 WP_004398685.1 hypothetical protein -
  K6J99_RS13960 (BsBEST3102_26760) yqaQ 2659588..2660043 (-) 456 WP_004398775.1 hypothetical protein -
  K6J99_RS13965 (BsBEST3102_26770) - 2660241..2661170 (+) 930 WP_003229913.1 hypothetical protein -
  K6J99_RS13970 (BsBEST3102_26780) yqaO 2661244..2661450 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  K6J99_RS13975 (BsBEST3102_26790) yqaN 2661532..2661960 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  K6J99_RS13980 (BsBEST3102_26800) - 2662056..2662205 (-) 150 WP_003229910.1 hypothetical protein -
  K6J99_RS13985 (BsBEST3102_26810) sknM 2662196..2663137 (-) 942 WP_075058863.1 ATP-binding protein -
  K6J99_RS13990 (BsBEST3102_26820) yqaL 2663019..2663696 (-) 678 WP_010886575.1 DnaD domain-containing protein -
  K6J99_RS13995 (BsBEST3102_26830) recT 2663772..2664626 (-) 855 WP_003229907.1 recombinase RecT -
  K6J99_RS14000 (BsBEST3102_26840) yqaJ 2664629..2665588 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  K6J99_RS14005 (BsBEST3102_26850) - 2665694..2665888 (-) 195 WP_003229905.1 YqaI family protein -
  K6J99_RS14010 (BsBEST3102_26860) - 2665848..2666021 (-) 174 WP_119123069.1 hypothetical protein -
  K6J99_RS14015 (BsBEST3102_26870) sknH 2666018..2666275 (-) 258 WP_003245994.1 YqaH family protein -
  K6J99_RS14020 (BsBEST3102_26880) yqaG 2666272..2666841 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  K6J99_RS14025 (BsBEST3102_26890) - 2666915..2667055 (-) 141 WP_003229902.1 hypothetical protein -
  K6J99_RS14030 (BsBEST3102_26900) yqaF 2667085..2667315 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  K6J99_RS14035 (BsBEST3102_26910) sknR 2667492..2667842 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=86961 K6J99_RS13710 WP_009967785.1 2620986..2621396(-) (nucA/comI) [Bacillus subtilis strain BEST3102]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=86961 K6J99_RS13710 WP_009967785.1 2620986..2621396(-) (nucA/comI) [Bacillus subtilis strain BEST3102]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529


Multiple sequence alignment