Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   Q9G86_RS12870 Genome accession   NZ_CP132200
Coordinates   2536866..2537144 (+) Length   92 a.a.
NCBI ID   WP_305926173.1    Uniprot ID   -
Organism   Bacillus thuringiensis strain L1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2525957..2568833 2536866..2537144 within 0


Gene organization within MGE regions


Location: 2525957..2568833
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q9G86_RS12790 (Q9G86_12790) - 2525957..2526199 (+) 243 WP_000494855.1 DUF3937 family protein -
  Q9G86_RS12795 (Q9G86_12795) - 2526748..2527077 (+) 330 WP_016512777.1 heterocycloanthracin/sonorensin family bacteriocin -
  Q9G86_RS12800 (Q9G86_12800) - 2527230..2527361 (+) 132 Protein_2448 site-specific integrase -
  Q9G86_RS12805 (Q9G86_12805) - 2527560..2528045 (+) 486 WP_002041181.1 hypothetical protein -
  Q9G86_RS12810 (Q9G86_12810) - 2528357..2529028 (+) 672 WP_000736204.1 pPIWI_RE module domain-containing protein -
  Q9G86_RS12815 (Q9G86_12815) - 2529097..2530206 (-) 1110 WP_305926170.1 tyrosine-type recombinase/integrase -
  Q9G86_RS12820 (Q9G86_12820) - 2530438..2530911 (+) 474 WP_063547376.1 hypothetical protein -
  Q9G86_RS12825 (Q9G86_12825) - 2531202..2532293 (+) 1092 WP_305926171.1 exosporium leader peptide-containing protein -
  Q9G86_RS12830 (Q9G86_12830) - 2532858..2534009 (+) 1152 WP_098256096.1 AimR family lysis-lysogeny pheromone receptor -
  Q9G86_RS12835 (Q9G86_12835) - 2534047..2534193 (+) 147 WP_000720927.1 hypothetical protein -
  Q9G86_RS12840 (Q9G86_12840) - 2534350..2534478 (+) 129 WP_255258933.1 hypothetical protein -
  Q9G86_RS12845 (Q9G86_12845) - 2534517..2534870 (-) 354 WP_000491272.1 helix-turn-helix domain-containing protein -
  Q9G86_RS12850 (Q9G86_12850) - 2535071..2535262 (+) 192 WP_000854271.1 helix-turn-helix domain-containing protein -
  Q9G86_RS12855 (Q9G86_12855) - 2535319..2535585 (+) 267 WP_000522028.1 helix-turn-helix domain-containing protein -
  Q9G86_RS12860 (Q9G86_12860) - 2535585..2535749 (+) 165 WP_047386177.1 hypothetical protein -
  Q9G86_RS12865 (Q9G86_12865) - 2535807..2536862 (+) 1056 WP_305926172.1 DnaD domain-containing protein -
  Q9G86_RS12870 (Q9G86_12870) abrB 2536866..2537144 (+) 279 WP_305926173.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  Q9G86_RS12875 (Q9G86_12875) - 2537137..2537496 (+) 360 WP_305926174.1 cell division protein SepF -
  Q9G86_RS12880 (Q9G86_12880) - 2537515..2537682 (+) 168 WP_000717826.1 DUF3954 domain-containing protein -
  Q9G86_RS12885 (Q9G86_12885) - 2537708..2537956 (+) 249 WP_305926175.1 helix-turn-helix domain containing protein -
  Q9G86_RS12890 (Q9G86_12890) - 2537979..2538434 (+) 456 WP_075719310.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  Q9G86_RS12895 (Q9G86_12895) - 2538701..2539489 (-) 789 WP_075719308.1 sulfotransferase family 2 domain-containing protein -
  Q9G86_RS12900 (Q9G86_12900) - 2540274..2540666 (-) 393 WP_000196761.1 thiol-disulfide oxidoreductase DCC family protein -
  Q9G86_RS12905 (Q9G86_12905) - 2540973..2541146 (+) 174 WP_305926176.1 hypothetical protein -
  Q9G86_RS12910 (Q9G86_12910) - 2541179..2541460 (+) 282 WP_075720498.1 hypothetical protein -
  Q9G86_RS12915 (Q9G86_12915) - 2541492..2541692 (+) 201 WP_080497311.1 hypothetical protein -
  Q9G86_RS12925 (Q9G86_12925) - 2545918..2546208 (-) 291 WP_075716704.1 hypothetical protein -
  Q9G86_RS12930 (Q9G86_12930) - 2546478..2546660 (+) 183 WP_075716703.1 hypothetical protein -
  Q9G86_RS12935 (Q9G86_12935) - 2547207..2547347 (+) 141 WP_305926177.1 DUF3983 domain-containing protein -
  Q9G86_RS12940 (Q9G86_12940) - 2547463..2547633 (+) 171 WP_098015618.1 hypothetical protein -
  Q9G86_RS12945 (Q9G86_12945) - 2547661..2548143 (+) 483 WP_075716701.1 ArpU family phage packaging/lysis transcriptional regulator -
  Q9G86_RS12950 (Q9G86_12950) - 2548143..2548685 (+) 543 WP_001012109.1 site-specific integrase -
  Q9G86_RS12955 (Q9G86_12955) - 2548969..2549676 (+) 708 WP_257146789.1 hypothetical protein -
  Q9G86_RS12960 (Q9G86_12960) - 2549969..2550688 (+) 720 WP_305926178.1 DUF4145 domain-containing protein -
  Q9G86_RS12965 (Q9G86_12965) - 2551069..2551353 (+) 285 WP_305926179.1 hypothetical protein -
  Q9G86_RS12970 (Q9G86_12970) - 2551535..2551765 (+) 231 WP_369812836.1 HNH endonuclease signature motif containing protein -
  Q9G86_RS12975 (Q9G86_12975) - 2551768..2552076 (+) 309 WP_179877396.1 hypothetical protein -
  Q9G86_RS12980 (Q9G86_12980) - 2552386..2552883 (+) 498 WP_305926181.1 P27 family phage terminase small subunit -
  Q9G86_RS12985 (Q9G86_12985) - 2552858..2554534 (+) 1677 WP_305926199.1 terminase TerL endonuclease subunit -
  Q9G86_RS12990 (Q9G86_12990) - 2554551..2555795 (+) 1245 WP_305926182.1 phage portal protein -
  Q9G86_RS12995 (Q9G86_12995) - 2555812..2556444 (+) 633 WP_003272656.1 head maturation protease, ClpP-related -
  Q9G86_RS13000 (Q9G86_13000) - 2556458..2557582 (+) 1125 WP_305926183.1 phage major capsid protein -
  Q9G86_RS13005 (Q9G86_13005) - 2557596..2557919 (+) 324 WP_305926184.1 hypothetical protein -
  Q9G86_RS13010 (Q9G86_13010) - 2557909..2558265 (+) 357 WP_000963758.1 hypothetical protein -
  Q9G86_RS13015 (Q9G86_13015) - 2558252..2558632 (+) 381 WP_016512759.1 hypothetical protein -
  Q9G86_RS13020 (Q9G86_13020) - 2558622..2559032 (+) 411 WP_001111193.1 hypothetical protein -
  Q9G86_RS13025 (Q9G86_13025) - 2559034..2559603 (+) 570 WP_001145608.1 hypothetical protein -
  Q9G86_RS13030 (Q9G86_13030) - 2559665..2560015 (+) 351 WP_000159510.1 hypothetical protein -
  Q9G86_RS13035 (Q9G86_13035) - 2560198..2564028 (+) 3831 WP_305926185.1 phage tail tape measure protein -
  Q9G86_RS13040 (Q9G86_13040) - 2564021..2564707 (+) 687 WP_000227695.1 hypothetical protein -
  Q9G86_RS13045 (Q9G86_13045) - 2564704..2567433 (+) 2730 WP_305926186.1 phage tail spike protein -
  Q9G86_RS13050 (Q9G86_13050) - 2567473..2567898 (+) 426 WP_097923822.1 holin family protein -
  Q9G86_RS13055 (Q9G86_13055) - 2567898..2568833 (+) 936 WP_097923823.1 N-acetylmuramoyl-L-alanine amidase -

Sequence


Protein


Download         Length: 92 a.a.        Molecular weight: 10240.88 Da        Isoelectric Point: 8.0411

>NTDB_id=867600 Q9G86_RS12870 WP_305926173.1 2536866..2537144(+) (abrB) [Bacillus thuringiensis strain L1]
MKNTGVARKVDELGRVVLPVELRRTLGIVEGTRLDFHVEGENIVLRKYEKSCFVTGKVSDSNIELLGGRMFLSKEGALEL
LNSLEKSVKEHG

Nucleotide


Download         Length: 279 bp        

>NTDB_id=867600 Q9G86_RS12870 WP_305926173.1 2536866..2537144(+) (abrB) [Bacillus thuringiensis strain L1]
ATGAAAAATACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTACTTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGAACGAGATTAGATTTTCATGTTGAGGGTGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACAGGTAAAGTATCTGATTCCAACATCGAATTGTTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGGGCACTTGAGTTA
CTCAACTCTCTTGAAAAGAGTGTGAAGGAACATGGCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

52.747

98.913

0.522