Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   WHO18_RS17260 Genome accession   NZ_CP148128
Coordinates   3256681..3256821 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate FELIX_MS620     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3251681..3261821
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO18_RS17235 yuxO 3251994..3252374 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHO18_RS17240 comA 3252393..3253037 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHO18_RS17245 comP 3253118..3255427 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  WHO18_RS17250 comX 3255442..3255609 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHO18_RS17255 comQ 3255597..3256496 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHO18_RS17260 degQ 3256681..3256821 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHO18_RS17265 - 3257043..3257168 (+) 126 WP_003228793.1 hypothetical protein -
  WHO18_RS17270 - 3257282..3257650 (+) 369 WP_003243784.1 hypothetical protein -
  WHO18_RS17275 pdeH 3257626..3258855 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHO18_RS17280 pncB 3258992..3260464 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  WHO18_RS17285 pncA 3260480..3261031 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  WHO18_RS17290 yueI 3261128..3261526 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=865865 WHO18_RS17260 WP_003220708.1 3256681..3256821(-) (degQ) [Bacillus subtilis isolate FELIX_MS620]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=865865 WHO18_RS17260 WP_003220708.1 3256681..3256821(-) (degQ) [Bacillus subtilis isolate FELIX_MS620]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1