Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   WHO38_RS17210 Genome accession   NZ_CP148124
Coordinates   3254586..3254753 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis isolate FELIX_MS521     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3249586..3259753
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO38_RS17180 mrpE 3249981..3250457 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  WHO38_RS17185 mrpF 3250457..3250741 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  WHO38_RS17190 mnhG 3250725..3251099 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  WHO38_RS17195 yuxO 3251138..3251518 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHO38_RS17200 comA 3251537..3252181 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHO38_RS17205 comP 3252262..3254571 (-) 2310 WP_277723628.1 two-component system sensor histidine kinase ComP Regulator
  WHO38_RS17210 comX 3254586..3254753 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHO38_RS17215 comQ 3254741..3255640 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHO38_RS17220 degQ 3255825..3255965 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHO38_RS17225 - 3256187..3256312 (+) 126 WP_003228793.1 hypothetical protein -
  WHO38_RS17230 - 3256426..3256794 (+) 369 WP_003243784.1 hypothetical protein -
  WHO38_RS17235 pdeH 3256770..3257999 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHO38_RS17240 pncB 3258136..3259608 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=865623 WHO38_RS17210 WP_003242801.1 3254586..3254753(-) (comX) [Bacillus subtilis isolate FELIX_MS521]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=865623 WHO38_RS17210 WP_003242801.1 3254586..3254753(-) (comX) [Bacillus subtilis isolate FELIX_MS521]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1