Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   WHO32_RS17245 Genome accession   NZ_CP148112
Coordinates   3256682..3256822 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate FELIX_MS504     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3251682..3261822
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO32_RS17220 yuxO 3251995..3252375 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHO32_RS17225 comA 3252394..3253038 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHO32_RS17230 comP 3253119..3255428 (-) 2310 WP_277723628.1 two-component system sensor histidine kinase ComP Regulator
  WHO32_RS17235 comX 3255443..3255610 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHO32_RS17240 comQ 3255598..3256497 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHO32_RS17245 degQ 3256682..3256822 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHO32_RS17250 - 3257044..3257169 (+) 126 WP_003228793.1 hypothetical protein -
  WHO32_RS17255 - 3257283..3257651 (+) 369 WP_003243784.1 hypothetical protein -
  WHO32_RS17260 pdeH 3257627..3258856 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHO32_RS17265 pncB 3258993..3260465 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  WHO32_RS17270 pncA 3260481..3261032 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  WHO32_RS17275 yueI 3261129..3261527 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=864671 WHO32_RS17245 WP_003220708.1 3256682..3256822(-) (degQ) [Bacillus subtilis isolate FELIX_MS504]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=864671 WHO32_RS17245 WP_003220708.1 3256682..3256822(-) (degQ) [Bacillus subtilis isolate FELIX_MS504]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1