Detailed information
Overview
| Name | cipB | Type | Regulator |
| Locus tag | Q7623_RS02935 | Genome accession | NZ_CP131710 |
| Coordinates | 552172..552321 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain 2014S11-203 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| IScluster/Tn | 550501..556405 | 552172..552321 | within | 0 |
Gene organization within MGE regions
Location: 550501..556405
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q7623_RS02920 (Q7623_02905) | - | 550501..551305 (+) | 805 | Protein_575 | IS5 family transposase | - |
| Q7623_RS02925 (Q7623_02910) | blpM | 551455..551709 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| Q7623_RS02930 (Q7623_02915) | blpN | 551725..551928 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| Q7623_RS02935 (Q7623_02920) | cipB | 552172..552321 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| Q7623_RS02940 (Q7623_02925) | - | 552425..552544 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| Q7623_RS02945 (Q7623_02930) | - | 553330..553749 (+) | 420 | WP_000877385.1 | hypothetical protein | - |
| Q7623_RS02950 (Q7623_02935) | - | 553764..554453 (+) | 690 | WP_000760521.1 | CPBP family intramembrane glutamic endopeptidase | - |
| Q7623_RS02955 (Q7623_02940) | blpZ | 554495..554728 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| Q7623_RS02960 (Q7623_02945) | - | 555059..556405 (+) | 1347 | WP_001808790.1 | IS1380-like element ISSpn5 family transposase | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=864101 Q7623_RS02935 WP_001809846.1 552172..552321(+) (cipB) [Streptococcus pneumoniae strain 2014S11-203]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=864101 Q7623_RS02935 WP_001809846.1 552172..552321(+) (cipB) [Streptococcus pneumoniae strain 2014S11-203]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |