Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   Q7625_RS02350 Genome accession   NZ_CP131708
Coordinates   458249..458398 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 2016C10-332     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 453249..463398
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q7625_RS02325 (Q7625_02325) comA/nlmT 454316..455992 (-) 1677 WP_196300924.1 peptide cleavage/export ABC transporter Regulator
  Q7625_RS02330 comA/nlmT 455886..456473 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  Q7625_RS02335 (Q7625_02330) blpI 456755..456952 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  Q7625_RS02340 (Q7625_02335) blpJ 457419..457688 (+) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  Q7625_RS02345 (Q7625_02340) blpK 457757..458005 (+) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  Q7625_RS02350 (Q7625_02345) cipB 458249..458398 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  Q7625_RS02355 (Q7625_02350) - 458502..458621 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  Q7625_RS02360 (Q7625_02355) - 459141..459460 (+) 320 Protein_463 immunity protein -
  Q7625_RS02365 (Q7625_02360) - 460089..460472 (+) 384 WP_000877381.1 hypothetical protein -
  Q7625_RS02370 (Q7625_02365) - 460524..461213 (+) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  Q7625_RS02375 (Q7625_02370) blpZ 461255..461488 (+) 234 WP_000276498.1 immunity protein BlpZ -
  Q7625_RS02380 (Q7625_02375) - 461639..462250 (+) 612 WP_000394044.1 type II CAAX endopeptidase family protein -
  Q7625_RS02385 (Q7625_02380) - 462411..463205 (+) 795 WP_000363002.1 phosphotransferase family protein -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=863949 Q7625_RS02350 WP_001809846.1 458249..458398(+) (cipB) [Streptococcus pneumoniae strain 2016C10-332]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=863949 Q7625_RS02350 WP_001809846.1 458249..458398(+) (cipB) [Streptococcus pneumoniae strain 2016C10-332]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531