Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   Q7626_RS02415 Genome accession   NZ_CP131707
Coordinates   482927..483076 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain 2018C08-270     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 481302..482060 482927..483076 flank 867


Gene organization within MGE regions


Location: 481302..483076
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q7626_RS02405 (Q7626_02400) blpM 482210..482464 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  Q7626_RS02410 (Q7626_02405) blpN 482480..482683 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  Q7626_RS02415 (Q7626_02410) cipB 482927..483076 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=863870 Q7626_RS02415 WP_001818346.1 482927..483076(+) (cipB) [Streptococcus pneumoniae strain 2018C08-270]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=863870 Q7626_RS02415 WP_001818346.1 482927..483076(+) (cipB) [Streptococcus pneumoniae strain 2018C08-270]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51