Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   Q7627_RS02675 Genome accession   NZ_CP131706
Coordinates   514449..514598 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 2018N21-288     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 512778..518682 514449..514598 within 0


Gene organization within MGE regions


Location: 512778..518682
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q7627_RS02660 (Q7627_02650) - 512778..513582 (+) 805 Protein_523 IS5 family transposase -
  Q7627_RS02665 (Q7627_02655) blpM 513732..513986 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  Q7627_RS02670 (Q7627_02660) blpN 514002..514205 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  Q7627_RS02675 (Q7627_02665) cipB 514449..514598 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  Q7627_RS02680 (Q7627_02670) - 514702..514821 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  Q7627_RS02685 (Q7627_02675) - 515607..516026 (+) 420 WP_000877385.1 hypothetical protein -
  Q7627_RS02690 (Q7627_02680) - 516041..516730 (+) 690 WP_341945023.1 lysostaphin resistance A-like protein -
  Q7627_RS02695 (Q7627_02685) blpZ 516772..517005 (+) 234 WP_000276498.1 immunity protein BlpZ -
  Q7627_RS02700 (Q7627_02690) - 517336..518682 (+) 1347 WP_001808790.1 IS1380-like element ISSpn5 family transposase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=863793 Q7627_RS02675 WP_001809846.1 514449..514598(+) (cipB) [Streptococcus pneumoniae strain 2018N21-288]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=863793 Q7627_RS02675 WP_001809846.1 514449..514598(+) (cipB) [Streptococcus pneumoniae strain 2018N21-288]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531