Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilK   Type   Machinery gene
Locus tag   Q7651_RS02695 Genome accession   NZ_CP131622
Coordinates   522053..522664 (+) Length   203 a.a.
NCBI ID   WP_123768185.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 2020N07-265     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 523209..561188 522053..522664 flank 545


Gene organization within MGE regions


Location: 522053..561188
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q7651_RS02695 (Q7651_02705) pilK 522053..522664 (+) 612 WP_123768185.1 pilus assembly protein Machinery gene
  Q7651_RS02700 (Q7651_02710) pilL 522666..523139 (+) 474 WP_012503482.1 PilX family type IV pilin Machinery gene
  Q7651_RS02705 (Q7651_02715) - 523209..523517 (-) 309 WP_025456241.1 AzlD family protein -
  Q7651_RS02710 (Q7651_02720) - 523514..524223 (-) 710 Protein_524 AzlC family ABC transporter permease -
  Q7651_RS02715 (Q7651_02725) dut 524389..524841 (+) 453 WP_003687923.1 dUTP diphosphatase -
  Q7651_RS02720 (Q7651_02730) dapC 524919..526106 (+) 1188 WP_123771553.1 succinyldiaminopimelate transaminase -
  Q7651_RS02725 (Q7651_02735) yaaA 526262..527041 (+) 780 WP_047917077.1 peroxide stress protein YaaA -
  Q7651_RS02740 (Q7651_02750) - 527571..528763 (+) 1193 Protein_528 integrase arm-type DNA-binding domain-containing protein -
  Q7651_RS02745 (Q7651_02755) - 529119..529388 (-) 270 WP_003687928.1 hypothetical protein -
  Q7651_RS02750 (Q7651_02760) - 529583..530266 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  Q7651_RS02755 - 530580..530813 (-) 234 Protein_531 hypothetical protein -
  Q7651_RS02760 (Q7651_02770) - 530924..531139 (-) 216 WP_003691538.1 hypothetical protein -
  Q7651_RS02765 (Q7651_02775) - 531191..531682 (-) 492 WP_003691537.1 siphovirus Gp157 family protein -
  Q7651_RS02770 (Q7651_02780) - 531679..531861 (-) 183 WP_003691535.1 hypothetical protein -
  Q7651_RS02775 (Q7651_02785) - 532001..532687 (-) 687 WP_042758540.1 hypothetical protein -
  Q7651_RS02780 (Q7651_02790) - 532756..532917 (-) 162 WP_003691530.1 hypothetical protein -
  Q7651_RS02785 (Q7651_02795) - 532914..533189 (-) 276 WP_003703838.1 hypothetical protein -
  Q7651_RS02790 (Q7651_02800) - 533342..533674 (-) 333 WP_003696914.1 hypothetical protein -
  Q7651_RS02795 (Q7651_02805) - 533815..534090 (-) 276 WP_341948103.1 hypothetical protein -
  Q7651_RS02800 (Q7651_02810) - 534087..534563 (-) 477 WP_002255718.1 hypothetical protein -
  Q7651_RS02805 (Q7651_02815) - 534596..534796 (-) 201 WP_003704298.1 hypothetical protein -
  Q7651_RS02810 (Q7651_02820) - 534994..535407 (-) 414 WP_003687963.1 hypothetical protein -
  Q7651_RS02815 (Q7651_02825) - 535404..535865 (-) 462 WP_003687965.1 helix-turn-helix transcriptional regulator -
  Q7651_RS02820 (Q7651_02830) - 535882..536319 (-) 438 WP_003687967.1 hypothetical protein -
  Q7651_RS02825 (Q7651_02835) - 536434..537150 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  Q7651_RS02830 (Q7651_02840) - 537219..537455 (+) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  Q7651_RS02835 (Q7651_02845) - 537535..537690 (+) 156 WP_003691446.1 hypothetical protein -
  Q7651_RS02840 (Q7651_02850) - 537667..537855 (-) 189 WP_003696008.1 hypothetical protein -
  Q7651_RS02845 (Q7651_02855) - 538028..538255 (+) 228 WP_003691442.1 helix-turn-helix domain-containing protein -
  Q7651_RS02850 (Q7651_02860) - 538252..539385 (+) 1134 WP_341948104.1 helix-turn-helix domain-containing protein -
  Q7651_RS02855 (Q7651_02865) - 539400..540182 (+) 783 WP_025456432.1 ATP-binding protein -
  Q7651_RS02860 (Q7651_02870) - 540252..540458 (+) 207 WP_154235934.1 hypothetical protein -
  Q7651_RS02865 (Q7651_02875) - 540497..540991 (+) 495 WP_048339679.1 DUF3310 domain-containing protein -
  Q7651_RS02870 (Q7651_02880) - 541170..541319 (+) 150 WP_003689110.1 hypothetical protein -
  Q7651_RS02875 (Q7651_02885) - 541347..541733 (+) 387 WP_341948105.1 hypothetical protein -
  Q7651_RS02880 (Q7651_02890) - 541630..542067 (+) 438 WP_341944764.1 RusA family crossover junction endodeoxyribonuclease -
  Q7651_RS02885 (Q7651_02895) - 542060..542365 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  Q7651_RS02890 (Q7651_02900) - 542362..542745 (+) 384 WP_003690918.1 recombination protein NinB -
  Q7651_RS02895 (Q7651_02905) - 542736..543254 (+) 519 WP_003693459.1 HNH endonuclease -
  Q7651_RS02900 (Q7651_02910) - 543319..543741 (+) 423 WP_003690919.1 hypothetical protein -
  Q7651_RS02905 (Q7651_02915) - 543741..544280 (+) 540 WP_003690920.1 hypothetical protein -
  Q7651_RS02910 (Q7651_02920) - 544261..545535 (+) 1275 WP_003701186.1 PBSX family phage terminase large subunit -
  Q7651_RS02915 (Q7651_02925) - 545520..547787 (+) 2268 WP_225577510.1 hypothetical protein -
  Q7651_RS02920 (Q7651_02930) - 548024..549220 (+) 1197 WP_003690925.1 hypothetical protein -
  Q7651_RS02925 (Q7651_02935) - 549217..550431 (+) 1215 WP_047954539.1 hypothetical protein -
  Q7651_RS02930 (Q7651_02940) - 553325..556429 (+) 3105 Protein_566 PLxRFG domain-containing protein -
  Q7651_RS02935 (Q7651_02945) - 556411..557148 (+) 738 WP_225577423.1 hypothetical protein -
  Q7651_RS02940 (Q7651_02950) - 557169..558464 (+) 1296 WP_003695011.1 DUF4043 family protein -
  Q7651_RS02945 (Q7651_02955) - 558519..558992 (+) 474 WP_003687996.1 hypothetical protein -
  Q7651_RS02950 (Q7651_02960) - 558998..559483 (+) 486 WP_003687997.1 hypothetical protein -
  Q7651_RS02955 (Q7651_02965) - 559480..560154 (+) 675 WP_003687998.1 hypothetical protein -
  Q7651_RS02960 (Q7651_02970) - 560157..560306 (+) 150 WP_003706419.1 hypothetical protein -
  Q7651_RS02965 (Q7651_02975) - 560343..561188 (-) 846 WP_048339506.1 Bro-N domain-containing protein -

Sequence

Protein


Download         Length: 203 a.a.        Molecular weight: 22031.95 Da        Isoelectric Point: 8.0862

>NTDB_id=862884 Q7651_RS02695 WP_123768185.1 522053..522664(+) (pilK) [Neisseria gonorrhoeae strain 2020N07-265]
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYAA
DSKVTFSENCEKGLCTAVNVRTNDNGNEEAFGNIVVQGKPTVEAVKRPCPAKSGKNSTGLCIDNQGVEYKKGTGNVSKMP
RYIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ

Nucleotide


Download         Length: 612 bp        

>NTDB_id=862884 Q7651_RS02695 WP_123768185.1 522053..522664(+) (pilK) [Neisseria gonorrhoeae strain 2020N07-265]
ATGCGCAAACAGAACACTTTGACGGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAGCAGCGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGCGGGAGGGCGAATTTCAGGTTTTGGATTTGGAATATGCTGCG
GACAGTAAGGTTACGTTTAGCGAAAACTGTGAAAAAGGTCTGTGTACCGCAGTGAATGTGCGGACAAATGATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGCAAGGCAAGCCCACCGTTGAGGCGGTGAAGCGTCCTTGCCCTGCAAAGTCTG
GCAAAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGTACGGGAAACGTCAGCAAAATGCCG
CGCTATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA

Domains

Predicted by InterproScan.

PilX N-terminal (PilX_N)

(17-67)

Type IV pilus assembly protein PilX C-term (PilX)

(92-198)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilK Neisseria gonorrhoeae MS11

95.567

100

0.956