Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilK   Type   Machinery gene
Locus tag   Q6388_RS02350 Genome accession   NZ_CP130895
Coordinates   448181..448780 (+) Length   199 a.a.
NCBI ID   WP_304672994.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain NJ1913940     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 449325..501177 448181..448780 flank 545


Gene organization within MGE regions


Location: 448181..501177
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q6388_RS02350 (Q6388_02350) pilK 448181..448780 (+) 600 WP_304672994.1 pilus assembly protein Machinery gene
  Q6388_RS02355 (Q6388_02355) pilL 448782..449255 (+) 474 WP_304673005.1 PilX family type IV pilin Machinery gene
  Q6388_RS02360 (Q6388_02360) - 449325..449633 (-) 309 WP_304672995.1 AzlD family protein -
  Q6388_RS02365 (Q6388_02365) - 449630..450338 (-) 709 Protein_462 AzlC family ABC transporter permease -
  Q6388_RS02370 (Q6388_02370) dut 450504..450956 (+) 453 WP_003702446.1 dUTP diphosphatase -
  Q6388_RS02375 (Q6388_02375) dapC 451034..452221 (+) 1188 WP_304672996.1 succinyldiaminopimelate transaminase -
  Q6388_RS02380 (Q6388_02380) yaaA 452377..453156 (+) 780 WP_003706583.1 peroxide stress protein YaaA -
  Q6388_RS02395 (Q6388_02395) - 453687..454880 (+) 1194 WP_010359935.1 integrase arm-type DNA-binding domain-containing protein -
  Q6388_RS02400 (Q6388_02400) - 455236..455505 (-) 270 WP_003687928.1 hypothetical protein -
  Q6388_RS02405 (Q6388_02405) - 455700..456383 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  Q6388_RS11720 - 456697..456930 (-) 234 Protein_469 hypothetical protein -
  Q6388_RS02415 (Q6388_02415) - 457041..457256 (-) 216 WP_003691538.1 hypothetical protein -
  Q6388_RS02420 (Q6388_02420) - 457308..457799 (-) 492 WP_003691537.1 siphovirus Gp157 family protein -
  Q6388_RS02425 (Q6388_02425) - 457796..457978 (-) 183 WP_003691535.1 hypothetical protein -
  Q6388_RS02430 (Q6388_02430) - 458118..458804 (-) 687 WP_050159915.1 phage replication initiation protein, NGO0469 family -
  Q6388_RS02435 (Q6388_02435) - 458873..459034 (-) 162 WP_003693867.1 hypothetical protein -
  Q6388_RS02440 (Q6388_02440) - 459031..459309 (-) 279 WP_003691529.1 NGO1622 family putative holin -
  Q6388_RS02445 (Q6388_02445) - 459463..459795 (-) 333 WP_003687946.1 hypothetical protein -
  Q6388_RS02450 (Q6388_02450) - 459936..460223 (-) 288 WP_126321982.1 hypothetical protein -
  Q6388_RS02455 (Q6388_02455) - 460220..460696 (-) 477 WP_002255718.1 hypothetical protein -
  Q6388_RS02460 (Q6388_02460) - 460729..460929 (-) 201 WP_047954343.1 hypothetical protein -
  Q6388_RS02465 (Q6388_02465) - 461127..461540 (-) 414 WP_003687963.1 hypothetical protein -
  Q6388_RS02470 (Q6388_02470) - 461537..461998 (-) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  Q6388_RS02475 (Q6388_02475) - 462015..462452 (-) 438 WP_003687967.1 hypothetical protein -
  Q6388_RS02480 (Q6388_02480) - 462565..463281 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  Q6388_RS02485 (Q6388_02485) - 463350..463586 (+) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  Q6388_RS02490 (Q6388_02490) - 463666..463821 (+) 156 WP_003689578.1 hypothetical protein -
  Q6388_RS02495 (Q6388_02495) - 463798..463986 (-) 189 WP_003691445.1 hypothetical protein -
  Q6388_RS02500 (Q6388_02500) - 464159..464386 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  Q6388_RS02505 (Q6388_02505) - 464383..464520 (+) 138 WP_010359998.1 hypothetical protein -
  Q6388_RS02510 (Q6388_02510) - 465065..465568 (+) 504 WP_010360005.1 hypothetical protein -
  Q6388_RS02515 (Q6388_02515) - 465565..466926 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  Q6388_RS02520 (Q6388_02520) - 467020..467226 (+) 207 WP_050172859.1 hypothetical protein -
  Q6388_RS02525 (Q6388_02525) - 467265..467759 (+) 495 WP_003691434.1 DUF3310 domain-containing protein -
  Q6388_RS02530 (Q6388_02530) - 467936..468085 (+) 150 WP_003689110.1 hypothetical protein -
  Q6388_RS02535 (Q6388_02535) - 468114..468395 (+) 282 WP_003689109.1 hypothetical protein -
  Q6388_RS02540 (Q6388_02540) - 468386..468766 (+) 381 WP_033911195.1 RusA family crossover junction endodeoxyribonuclease -
  Q6388_RS02545 (Q6388_02545) - 468783..468911 (-) 129 WP_012503747.1 hypothetical protein -
  Q6388_RS02550 (Q6388_02550) - 469033..469440 (+) 408 WP_003691430.1 hypothetical protein -
  Q6388_RS02555 (Q6388_02555) - 469531..470691 (+) 1161 WP_047919575.1 type I restriction endonuclease -
  Q6388_RS02560 (Q6388_02560) - 470972..471841 (+) 870 WP_103195306.1 BRO family protein -
  Q6388_RS02565 (Q6388_02565) - 472134..472583 (+) 450 WP_003695485.1 hypothetical protein -
  Q6388_RS02570 (Q6388_02570) terL 472645..474066 (+) 1422 WP_003697216.1 phage terminase large subunit -
  Q6388_RS02575 (Q6388_02575) - 474063..476210 (+) 2148 WP_003691423.1 phage portal protein -
  Q6388_RS02580 (Q6388_02580) - 476278..477435 (+) 1158 WP_047918052.1 HK97 family phage prohead protease -
  Q6388_RS02585 (Q6388_02585) - 477476..478975 (+) 1500 WP_003691419.1 hypothetical protein -
  Q6388_RS02590 (Q6388_02590) - 478982..479338 (+) 357 WP_003691418.1 hypothetical protein -
  Q6388_RS02595 (Q6388_02595) - 479341..479871 (+) 531 WP_003689080.1 head-tail connector protein -
  Q6388_RS02600 (Q6388_02600) - 479871..480353 (+) 483 WP_041421297.1 HK97 gp10 family phage protein -
  Q6388_RS02605 (Q6388_02605) - 480350..480778 (+) 429 WP_003689076.1 hypothetical protein -
  Q6388_RS02610 (Q6388_02610) - 480804..481577 (+) 774 WP_003692869.1 hypothetical protein -
  Q6388_RS02615 (Q6388_02615) - 481638..481967 (+) 330 WP_003692871.1 hypothetical protein -
  Q6388_RS02620 (Q6388_02620) - 481979..482245 (+) 267 WP_003689070.1 hypothetical protein -
  Q6388_RS02625 (Q6388_02625) - 482245..482844 (+) 600 WP_003692874.1 DUF2460 domain-containing protein -
  Q6388_RS02630 (Q6388_02630) - 482841..483695 (+) 855 WP_003698614.1 DUF2163 domain-containing protein -
  Q6388_RS02635 (Q6388_02635) - 483697..484128 (+) 432 WP_003689064.1 NlpC/P60 family protein -
  Q6388_RS02640 (Q6388_02640) - 484156..484434 (-) 279 WP_003689062.1 helix-turn-helix domain-containing protein -
  Q6388_RS02645 (Q6388_02645) - 484674..488819 (+) 4146 WP_304672997.1 phage tail protein -
  Q6388_RS02650 (Q6388_02650) - 488931..489236 (+) 306 WP_003689058.1 hypothetical protein -
  Q6388_RS02655 (Q6388_02655) - 489307..489777 (+) 471 WP_003691410.1 hypothetical protein -
  Q6388_RS02660 (Q6388_02660) - 489778..490110 (+) 333 WP_003691408.1 hypothetical protein -
  Q6388_RS02665 (Q6388_02665) - 490238..490471 (-) 234 WP_003692884.1 hypothetical protein -
  Q6388_RS02670 (Q6388_02670) - 490479..490826 (-) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  Q6388_RS02675 (Q6388_02675) - 490826..491062 (-) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  Q6388_RS02680 (Q6388_02680) - 491102..491227 (+) 126 WP_255294325.1 hypothetical protein -
  Q6388_RS02685 (Q6388_02685) - 491269..491808 (+) 540 WP_103195302.1 TIGR02594 family protein -
  Q6388_RS02690 (Q6388_02690) - 491808..491966 (+) 159 WP_003691816.1 hypothetical protein -
  Q6388_RS02695 (Q6388_02695) - 491950..492291 (+) 342 WP_003696082.1 hypothetical protein -
  Q6388_RS02700 (Q6388_02700) - 492968..496012 (+) 3045 WP_103195301.1 tape measure protein -
  Q6388_RS02705 (Q6388_02705) - 496072..496551 (-) 480 WP_002241413.1 DUF4760 domain-containing protein -
  Q6388_RS02710 (Q6388_02710) - 496893..497882 (-) 990 WP_003689040.1 site-specific integrase -
  Q6388_RS02715 (Q6388_02715) - 498142..498330 (-) 189 WP_003689039.1 hypothetical protein -
  Q6388_RS02720 (Q6388_02720) purM 498571..499605 (+) 1035 WP_003692893.1 phosphoribosylformylglycinamidine cyclo-ligase -

Sequence

Protein


Download         Length: 199 a.a.        Molecular weight: 21620.49 Da        Isoelectric Point: 8.0870

>NTDB_id=861874 Q6388_RS02350 WP_304672994.1 448181..448780(+) (pilK) [Neisseria gonorrhoeae strain NJ1913940]
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYAA
DSKVTFSENCEKGLCTAVNVRTNNNGNEEAFGNIVVKGKPTVEAVKRSCPANSASLCIDNQGVEYKKGTGNVSKMPRYII
EYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ

Nucleotide


Download         Length: 600 bp        

>NTDB_id=861874 Q6388_RS02350 WP_304672994.1 448181..448780(+) (pilK) [Neisseria gonorrhoeae strain NJ1913940]
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGCGGGAGGGCGAATTTCAGGTTTTGGATTTGGAATATGCTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAAAGGCCTGTGTACCGCAGTGAATGTGCGGACAAATAATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGAAAGGCAAGCCCACCGTTGAGGCCGTGAAGCGTTCTTGCCCTGCAAATTCTG
CCAGCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGTACGGGAAACGTCAGCAAAATGCCGCGCTATATTATC
GAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGCCAATACCGTGGT
CGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA

Domains

Predicted by InterproScan.

PilX N-terminal (PilX_N)

(17-67)

Type IV pilus assembly protein PilX C-term (PilX)

(92-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilK Neisseria gonorrhoeae MS11

93.103

100

0.95