Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilH   Type   Machinery gene
Locus tag   Q6386_RS07890 Genome accession   NZ_CP130891
Coordinates   1501449..1502114 (-) Length   221 a.a.
NCBI ID   WP_047918678.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain NJ208430     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1446839..1509066 1501449..1502114 within 0


Gene organization within MGE regions


Location: 1446839..1509066
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q6386_RS07500 (Q6386_07500) - 1446839..1447492 (-) 654 WP_203004369.1 IS1595 family transposase -
  Q6386_RS07505 (Q6386_07505) purM 1448490..1449524 (-) 1035 WP_003692893.1 phosphoribosylformylglycinamidine cyclo-ligase -
  Q6386_RS07510 (Q6386_07510) - 1449765..1449953 (+) 189 WP_003689039.1 hypothetical protein -
  Q6386_RS07515 (Q6386_07515) - 1450213..1451202 (+) 990 WP_003689040.1 site-specific integrase -
  Q6386_RS07520 (Q6386_07520) - 1451544..1452023 (+) 480 WP_002241413.1 DUF4760 domain-containing protein -
  Q6386_RS07525 (Q6386_07525) - 1452083..1455130 (-) 3048 WP_304672882.1 tape measure protein -
  Q6386_RS07530 (Q6386_07530) - 1455648..1455821 (-) 174 WP_017146757.1 hypothetical protein -
  Q6386_RS07535 (Q6386_07535) - 1455805..1456146 (-) 342 WP_003696082.1 hypothetical protein -
  Q6386_RS07540 (Q6386_07540) - 1456130..1456288 (-) 159 WP_003691816.1 hypothetical protein -
  Q6386_RS07545 (Q6386_07545) - 1456288..1456827 (-) 540 WP_050169697.1 TIGR02594 family protein -
  Q6386_RS07550 (Q6386_07550) - 1456869..1456994 (-) 126 WP_255294325.1 hypothetical protein -
  Q6386_RS07555 (Q6386_07555) - 1457034..1457270 (+) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  Q6386_RS07560 (Q6386_07560) - 1457270..1457617 (+) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  Q6386_RS07565 (Q6386_07565) - 1457971..1458303 (-) 333 WP_003691408.1 hypothetical protein -
  Q6386_RS07570 (Q6386_07570) - 1458304..1458774 (-) 471 WP_003691410.1 hypothetical protein -
  Q6386_RS07575 (Q6386_07575) - 1458845..1459150 (-) 306 WP_003689058.1 hypothetical protein -
  Q6386_RS07580 (Q6386_07580) - 1459262..1463407 (-) 4146 WP_025456258.1 phage tail protein -
  Q6386_RS07585 (Q6386_07585) - 1463647..1463925 (+) 279 WP_003689062.1 helix-turn-helix domain-containing protein -
  Q6386_RS07590 (Q6386_07590) - 1463953..1464384 (-) 432 WP_003689064.1 NlpC/P60 family protein -
  Q6386_RS07595 (Q6386_07595) - 1464386..1465240 (-) 855 WP_003698614.1 DUF2163 domain-containing protein -
  Q6386_RS07600 (Q6386_07600) - 1465237..1465836 (-) 600 WP_003692874.1 DUF2460 domain-containing protein -
  Q6386_RS07605 (Q6386_07605) - 1465836..1466102 (-) 267 WP_003689070.1 hypothetical protein -
  Q6386_RS07610 (Q6386_07610) - 1466114..1466443 (-) 330 WP_003692871.1 hypothetical protein -
  Q6386_RS07615 (Q6386_07615) - 1466504..1467277 (-) 774 WP_003691416.1 hypothetical protein -
  Q6386_RS07620 (Q6386_07620) - 1467303..1467731 (-) 429 WP_003697213.1 hypothetical protein -
  Q6386_RS07625 (Q6386_07625) - 1467728..1468210 (-) 483 WP_003703855.1 HK97 gp10 family phage protein -
  Q6386_RS07630 (Q6386_07630) - 1468210..1468740 (-) 531 WP_003689080.1 head-tail connector protein -
  Q6386_RS07635 (Q6386_07635) - 1468743..1469087 (-) 345 WP_050169361.1 hypothetical protein -
  Q6386_RS07640 (Q6386_07640) - 1469094..1470593 (-) 1500 WP_003691419.1 hypothetical protein -
  Q6386_RS07645 (Q6386_07645) - 1470634..1471791 (-) 1158 WP_047918052.1 HK97 family phage prohead protease -
  Q6386_RS07650 (Q6386_07650) - 1471859..1474006 (-) 2148 WP_003691423.1 phage portal protein -
  Q6386_RS07655 (Q6386_07655) terL 1474003..1475424 (-) 1422 WP_003697216.1 phage terminase large subunit -
  Q6386_RS07660 (Q6386_07660) - 1475486..1475935 (-) 450 WP_003695485.1 hypothetical protein -
  Q6386_RS07665 (Q6386_07665) - 1476228..1477097 (-) 870 WP_103195306.1 BRO family protein -
  Q6386_RS07670 (Q6386_07670) - 1477378..1478538 (-) 1161 WP_304672883.1 type I restriction endonuclease -
  Q6386_RS07675 (Q6386_07675) - 1478629..1479036 (-) 408 WP_103195307.1 hypothetical protein -
  Q6386_RS07680 (Q6386_07680) - 1479158..1479286 (+) 129 WP_012503747.1 hypothetical protein -
  Q6386_RS07685 (Q6386_07685) - 1479303..1479683 (-) 381 WP_240335687.1 RusA family crossover junction endodeoxyribonuclease -
  Q6386_RS07690 (Q6386_07690) - 1479674..1479955 (-) 282 WP_003689109.1 hypothetical protein -
  Q6386_RS07695 (Q6386_07695) - 1479984..1480133 (-) 150 WP_047950098.1 hypothetical protein -
  Q6386_RS07700 (Q6386_07700) - 1480155..1480610 (-) 456 WP_050164337.1 DUF3310 domain-containing protein -
  Q6386_RS07705 (Q6386_07705) - 1480649..1480912 (-) 264 WP_154235914.1 hypothetical protein -
  Q6386_RS07710 (Q6386_07710) - 1480949..1482310 (-) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  Q6386_RS07715 (Q6386_07715) - 1482307..1482810 (-) 504 WP_010360005.1 hypothetical protein -
  Q6386_RS07720 (Q6386_07720) - 1483355..1483492 (-) 138 WP_010359998.1 hypothetical protein -
  Q6386_RS07725 (Q6386_07725) - 1483489..1483716 (-) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  Q6386_RS07730 (Q6386_07730) - 1483889..1484077 (+) 189 WP_003691445.1 hypothetical protein -
  Q6386_RS07735 (Q6386_07735) - 1484054..1484209 (-) 156 WP_003689578.1 hypothetical protein -
  Q6386_RS07740 (Q6386_07740) - 1484289..1484525 (-) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  Q6386_RS07745 (Q6386_07745) - 1484648..1485310 (+) 663 WP_012503489.1 LexA family transcriptional regulator -
  Q6386_RS07750 (Q6386_07750) - 1485423..1485860 (+) 438 WP_003687967.1 hypothetical protein -
  Q6386_RS07755 (Q6386_07755) - 1485877..1486338 (+) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  Q6386_RS07760 (Q6386_07760) - 1486335..1486748 (+) 414 WP_003687963.1 hypothetical protein -
  Q6386_RS07765 (Q6386_07765) - 1486946..1487146 (+) 201 WP_047954343.1 hypothetical protein -
  Q6386_RS07770 (Q6386_07770) - 1487179..1487655 (+) 477 WP_002255718.1 hypothetical protein -
  Q6386_RS07775 (Q6386_07775) - 1487652..1487927 (+) 276 WP_103195391.1 hypothetical protein -
  Q6386_RS07780 (Q6386_07780) - 1488068..1488400 (+) 333 WP_003687946.1 hypothetical protein -
  Q6386_RS07785 (Q6386_07785) - 1488553..1488831 (+) 279 WP_003691529.1 NGO1622 family putative holin -
  Q6386_RS07790 (Q6386_07790) - 1488828..1488989 (+) 162 WP_003693867.1 hypothetical protein -
  Q6386_RS07795 (Q6386_07795) - 1489058..1489744 (+) 687 WP_050159915.1 phage replication initiation protein, NGO0469 family -
  Q6386_RS07800 (Q6386_07800) - 1489884..1490066 (+) 183 WP_003691535.1 hypothetical protein -
  Q6386_RS07805 (Q6386_07805) - 1490063..1490554 (+) 492 WP_003691537.1 siphovirus Gp157 family protein -
  Q6386_RS07810 (Q6386_07810) - 1490606..1490821 (+) 216 WP_003691538.1 hypothetical protein -
  Q6386_RS11765 - 1490932..1491165 (+) 234 Protein_1499 hypothetical protein -
  Q6386_RS07820 (Q6386_07820) - 1491479..1492162 (+) 684 WP_003687929.1 DUF2786 domain-containing protein -
  Q6386_RS07825 (Q6386_07825) - 1492357..1492626 (+) 270 WP_003687928.1 hypothetical protein -
  Q6386_RS07830 (Q6386_07830) - 1492982..1494175 (-) 1194 WP_010359935.1 integrase arm-type DNA-binding domain-containing protein -
  Q6386_RS07845 (Q6386_07845) yaaA 1494706..1495485 (-) 780 WP_003706583.1 peroxide stress protein YaaA -
  Q6386_RS07850 (Q6386_07850) dapC 1495796..1496983 (-) 1188 WP_047949582.1 succinyldiaminopimelate transaminase -
  Q6386_RS07855 (Q6386_07855) dut 1497061..1497513 (-) 453 WP_103195211.1 dUTP diphosphatase -
  Q6386_RS07860 (Q6386_07860) - 1497679..1498386 (+) 708 Protein_1506 AzlC family ABC transporter permease -
  Q6386_RS07865 (Q6386_07865) - 1498383..1498691 (+) 309 WP_010951048.1 AzlD family protein -
  Q6386_RS07870 (Q6386_07870) pilL 1498761..1499237 (-) 477 WP_203004379.1 PilX family type IV pilin Machinery gene
  Q6386_RS07875 (Q6386_07875) pilK 1499239..1499850 (-) 612 WP_003687918.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  Q6386_RS07880 (Q6386_07880) pilJ 1499829..1500809 (-) 981 WP_010951046.1 PilW family protein Machinery gene
  Q6386_RS07885 (Q6386_07885) pilV 1500806..1501417 (-) 612 WP_050169631.1 type IV pilus modification protein PilV Machinery gene
  Q6386_RS07890 (Q6386_07890) pilH 1501449..1502114 (-) 666 WP_047918678.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  Q6386_RS07895 (Q6386_07895) dnaB 1502269..1503675 (-) 1407 WP_047917169.1 replicative DNA helicase -
  Q6386_RS07900 (Q6386_07900) - 1503839..1504420 (+) 582 WP_047923823.1 superoxide dismutase -
  Q6386_RS07905 (Q6386_07905) - 1504652..1505161 (-) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  Q6386_RS07910 (Q6386_07910) - 1505492..1505824 (-) 333 WP_003687908.1 hypothetical protein -
  Q6386_RS07915 (Q6386_07915) cysT 1506010..1506839 (+) 830 Protein_1517 sulfate ABC transporter permease subunit CysT -
  Q6386_RS07920 (Q6386_07920) cysW 1507028..1507849 (+) 822 WP_103195209.1 sulfate ABC transporter permease subunit CysW -
  Q6386_RS07925 (Q6386_07925) - 1507845..1507952 (+) 108 Protein_1519 IS5/IS1182 family transposase -
  Q6386_RS07930 (Q6386_07930) - 1507990..1509066 (+) 1077 WP_003687905.1 sulfate/molybdate ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 221 a.a.        Molecular weight: 24613.96 Da        Isoelectric Point: 8.6140

>NTDB_id=861700 Q6386_RS07890 WP_047918678.1 1501449..1502114(-) (pilH) [Neisseria gonorrhoeae strain NJ208430]
MCTRKQQGFTLTELLIVMAIAAIMATIALPNMSGWIASRRIASHAEQIANLLRFSRGEAVRLNLPVYICPAQVKKDGTVD
NQCDFGKKEQGMLAFGDKNDNKAYDGDAADVFLRNVVLNDDIKDKRINYTFNHIAFGSSQPTADRVVWTFNQNGTFGYTK
DQHLASTSSFFYSDGYIQIVLTDARAVSDADRKFRSAVVLIDSSGRVEVCRKNDTRAVCKH

Nucleotide


Download         Length: 666 bp        

>NTDB_id=861700 Q6386_RS07890 WP_047918678.1 1501449..1502114(-) (pilH) [Neisseria gonorrhoeae strain NJ208430]
ATGTGTACACGAAAACAACAAGGTTTCACGCTAACAGAGCTGCTCATCGTGATGGCCATTGCAGCCATTATGGCGACGAT
AGCCCTCCCCAATATGAGTGGGTGGATTGCATCACGCCGCATTGCCAGTCACGCGGAGCAGATTGCCAACCTTTTGCGTT
TCTCCAGGGGCGAAGCCGTCCGGCTCAATCTCCCTGTCTATATCTGTCCTGCCCAAGTTAAAAAAGACGGTACGGTCGAC
AACCAATGCGACTTCGGTAAGAAGGAACAGGGGATGTTGGCTTTCGGCGACAAAAACGACAATAAGGCATATGACGGCGA
TGCTGCGGATGTTTTTCTCCGTAACGTGGTATTGAATGATGATATCAAGGATAAGCGGATTAATTACACCTTCAATCATA
TCGCTTTCGGTTCGTCTCAGCCGACCGCCGACCGTGTAGTTTGGACATTCAATCAAAACGGGACGTTCGGTTATACGAAA
GACCAGCATCTTGCAAGCACATCCAGCTTTTTTTATTCCGACGGTTATATCCAAATCGTGCTGACAGATGCGAGAGCAGT
TTCAGATGCCGATAGGAAATTCCGTTCGGCGGTGGTTTTGATTGACAGCAGCGGCAGGGTCGAAGTTTGTCGTAAAAACG
ATACGCGCGCCGTATGCAAACATTAA

Domains

Predicted by InterproScan.

Type II transport protein GspH (GspH)

(44-205)

Prokaryotic N-terminal methylation motif (N_methyl)

(4-29)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilH Neisseria gonorrhoeae MS11

86.878

100

0.869