Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   FLY91_RS19540 Genome accession   NZ_AP024560
Coordinates   4061839..4062468 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain NIPH17_0020     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 4052667..4090200 4061839..4062468 within 0


Gene organization within MGE regions


Location: 4052667..4090200
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FLY91_RS19490 tusE 4052938..4053267 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  FLY91_RS19495 yccX 4053264..4053542 (-) 279 WP_000048250.1 acylphosphatase -
  FLY91_RS19500 rlmI 4053637..4054827 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  FLY91_RS19505 hspQ 4054885..4055202 (+) 318 WP_001295356.1 heat shock protein HspQ -
  FLY91_RS19510 yccU 4055247..4055660 (-) 414 WP_000665217.1 CoA-binding protein -
  FLY91_RS19515 yccT 4055833..4056495 (+) 663 WP_000847791.1 DUF2057 family protein -
  FLY91_RS19520 mgsA 4056591..4057049 (+) 459 WP_000424181.1 methylglyoxal synthase -
  FLY91_RS19525 helD 4057081..4059135 (-) 2055 WP_000420536.1 DNA helicase IV -
  FLY91_RS19530 yccF 4059258..4059704 (+) 447 WP_001261235.1 YccF domain-containing protein -
  FLY91_RS19535 yccS 4059714..4061876 (+) 2163 WP_000875023.1 YccS family putative transporter -
  FLY91_RS19540 sxy/tfoX 4061839..4062468 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  FLY91_RS19545 sulA 4062687..4063196 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  FLY91_RS19550 ompA 4063553..4064605 (+) 1053 WP_001361736.1 porin OmpA -
  FLY91_RS19555 matP 4064681..4065133 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  FLY91_RS19560 ycbZ 4065319..4067079 (+) 1761 WP_000156526.1 Lon protease family protein -
  FLY91_RS19565 fabA 4067148..4067666 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  FLY91_RS19570 rmf 4067736..4067903 (-) 168 WP_000828648.1 ribosome modulation factor -
  FLY91_RS19575 pqiC 4068159..4068722 (-) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  FLY91_RS19580 pqiB 4068719..4070359 (-) 1641 WP_000445535.1 intermembrane transport protein PqiB -
  FLY91_RS19585 pqiA 4070364..4071617 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  FLY91_RS19590 uup 4071747..4073654 (-) 1908 WP_000053069.1 ABC transporter ATP-binding protein -
  FLY91_RS19595 rlmKL 4073666..4075774 (-) 2109 WP_001086520.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  FLY91_RS19600 ycbX 4076018..4077127 (+) 1110 WP_000224270.1 6-N-hydroxylaminopurine resistance protein YcbX -
  FLY91_RS19605 zapC 4077124..4077666 (-) 543 WP_001372781.1 cell division protein ZapC -
  FLY91_RS19610 pyrD 4077840..4078850 (-) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  FLY91_RS19615 ycbF 4078961..4079698 (-) 738 WP_001111449.1 fimbrial chaperone -
  FLY91_RS19620 ycbV 4079664..4080179 (-) 516 WP_000919480.1 fimbrial protein -
  FLY91_RS19625 ycbU 4080187..4080729 (-) 543 WP_000730614.1 fimbrial protein -
  FLY91_RS19630 elfG 4080741..4081811 (-) 1071 WP_060621153.1 fimbrial protein -
  FLY91_RS19635 elfC 4081802..4084402 (-) 2601 WP_000286313.1 fimbrial biogenesis usher protein -
  FLY91_RS19640 - 4084427..4084642 (-) 216 Protein_3880 fimbrial protein -
  FLY91_RS19645 - 4084671..4085784 (-) 1114 Protein_3881 IS3-like element ISSen4 family transposase -
  FLY91_RS19650 - 4085855..4086346 (-) 492 Protein_3882 molecular chaperone -
  FLY91_RS19655 - 4086429..4086971 (-) 543 WP_000750284.1 fimbrial protein -
  FLY91_RS19660 ssuE 4087327..4087902 (+) 576 WP_001263933.1 NADPH-dependent FMN reductase -
  FLY91_RS19665 ssuA 4087895..4088854 (+) 960 WP_001244343.1 aliphatic sulfonate ABC transporter substrate-binding protein SsuA -
  FLY91_RS19670 ssuD 4088851..4089996 (+) 1146 WP_000055996.1 FMNH2-dependent alkanesulfonate monooxygenase -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=85979 FLY91_RS19540 WP_000839153.1 4061839..4062468(-) (sxy/tfoX) [Escherichia coli strain NIPH17_0020]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=85979 FLY91_RS19540 WP_000839153.1 4061839..4062468(-) (sxy/tfoX) [Escherichia coli strain NIPH17_0020]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1

Multiple sequence alignment