Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   WBI56_RS16070 Genome accession   NZ_CP147492
Coordinates   3091798..3091938 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain MC4-2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3086798..3096938
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WBI56_RS16045 (WBI56_16045) yuxO 3087074..3087454 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  WBI56_RS16050 (WBI56_16050) comA 3087473..3088117 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WBI56_RS16055 (WBI56_16055) comP 3088198..3090510 (-) 2313 WP_047183111.1 histidine kinase Regulator
  WBI56_RS16060 (WBI56_16060) comX 3090526..3090747 (-) 222 WP_014114983.1 competence pheromone ComX -
  WBI56_RS16065 (WBI56_16065) comQ 3090744..3091613 (-) 870 WP_169037713.1 polyprenyl synthetase family protein Regulator
  WBI56_RS16070 (WBI56_16070) degQ 3091798..3091938 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WBI56_RS16075 (WBI56_16075) - 3092160..3092285 (+) 126 WP_338730755.1 hypothetical protein -
  WBI56_RS16080 (WBI56_16080) - 3092400..3092768 (+) 369 WP_017695529.1 hypothetical protein -
  WBI56_RS16085 (WBI56_16085) pdeH 3092744..3093973 (-) 1230 WP_338730756.1 cyclic di-GMP phosphodiesterase -
  WBI56_RS16090 (WBI56_16090) pncB 3094110..3095582 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  WBI56_RS16095 (WBI56_16095) pncA 3095598..3096149 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  WBI56_RS16100 (WBI56_16100) yueI 3096246..3096644 (-) 399 WP_338730758.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=859424 WBI56_RS16070 WP_003220708.1 3091798..3091938(-) (degQ) [Bacillus subtilis strain MC4-2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=859424 WBI56_RS16070 WP_003220708.1 3091798..3091938(-) (degQ) [Bacillus subtilis strain MC4-2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1