Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | Q2310_RS12820 | Genome accession | NZ_CP130491 |
| Coordinates | 2504128..2504406 (+) | Length | 92 a.a. |
| NCBI ID | WP_061113074.1 | Uniprot ID | A0AAX1SVI8 |
| Organism | Bacillus cereus strain T | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2493777..2537705 | 2504128..2504406 | within | 0 |
Gene organization within MGE regions
Location: 2493777..2537705
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q2310_RS12745 (Q2310_12715) | - | 2493777..2494040 (+) | 264 | WP_016122577.1 | DUF3937 family protein | - |
| Q2310_RS12750 (Q2310_12720) | - | 2494594..2494914 (+) | 321 | WP_001071364.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| Q2310_RS12755 (Q2310_12725) | - | 2495060..2495194 (+) | 135 | Protein_2434 | site-specific integrase | - |
| Q2310_RS12760 (Q2310_12730) | - | 2495404..2495889 (+) | 486 | WP_002024190.1 | hypothetical protein | - |
| Q2310_RS12765 (Q2310_12735) | - | 2496201..2496902 (+) | 702 | WP_063264103.1 | pPIWI_RE module domain-containing protein | - |
| Q2310_RS12770 (Q2310_12740) | - | 2496957..2498051 (-) | 1095 | Protein_2437 | tyrosine-type recombinase/integrase | - |
| Q2310_RS12775 (Q2310_12745) | - | 2498355..2499485 (+) | 1131 | WP_283749780.1 | exosporium leader peptide-containing protein | - |
| Q2310_RS12780 (Q2310_12750) | - | 2500122..2501273 (+) | 1152 | WP_063264104.1 | AimR family lysis-lysogeny pheromone receptor | - |
| Q2310_RS12785 (Q2310_12755) | - | 2501311..2501457 (+) | 147 | WP_000720922.1 | hypothetical protein | - |
| Q2310_RS12790 (Q2310_12760) | - | 2501613..2501741 (+) | 129 | WP_255290694.1 | hypothetical protein | - |
| Q2310_RS12795 (Q2310_12765) | - | 2501779..2502132 (-) | 354 | WP_000491236.1 | helix-turn-helix domain-containing protein | - |
| Q2310_RS12800 (Q2310_12770) | - | 2502333..2502524 (+) | 192 | WP_000854268.1 | helix-turn-helix domain-containing protein | - |
| Q2310_RS12805 (Q2310_12775) | - | 2502581..2502847 (+) | 267 | WP_000522030.1 | helix-turn-helix domain-containing protein | - |
| Q2310_RS12810 (Q2310_12780) | - | 2502847..2503011 (+) | 165 | WP_080444712.1 | hypothetical protein | - |
| Q2310_RS12815 (Q2310_12785) | - | 2503069..2504124 (+) | 1056 | WP_061113073.1 | DnaD domain-containing protein | - |
| Q2310_RS12820 (Q2310_12790) | abrB | 2504128..2504406 (+) | 279 | WP_061113074.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| Q2310_RS12825 (Q2310_12795) | - | 2504399..2504758 (+) | 360 | WP_061113075.1 | hypothetical protein | - |
| Q2310_RS12830 (Q2310_12800) | - | 2504777..2504944 (+) | 168 | WP_064774789.1 | DUF3954 domain-containing protein | - |
| Q2310_RS12835 (Q2310_12805) | - | 2504970..2505221 (+) | 252 | WP_061113076.1 | hypothetical protein | - |
| Q2310_RS12840 (Q2310_12810) | - | 2505241..2505723 (+) | 483 | WP_061113077.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| Q2310_RS12845 (Q2310_12815) | - | 2505762..2506172 (+) | 411 | WP_061113078.1 | hypothetical protein | - |
| Q2310_RS12850 (Q2310_12820) | - | 2506785..2506997 (+) | 213 | WP_061113336.1 | hypothetical protein | - |
| Q2310_RS12855 (Q2310_12825) | - | 2507082..2507810 (+) | 729 | WP_061113335.1 | DNA cytosine methyltransferase | - |
| Q2310_RS12860 (Q2310_12830) | - | 2507856..2508050 (+) | 195 | WP_061113334.1 | hypothetical protein | - |
| Q2310_RS12865 (Q2310_12835) | - | 2508308..2509615 (-) | 1308 | WP_063264105.1 | BclA C-terminal domain-containing protein | - |
| Q2310_RS12870 (Q2310_12840) | - | 2510514..2510696 (+) | 183 | WP_061113365.1 | hypothetical protein | - |
| Q2310_RS12875 (Q2310_12845) | - | 2510813..2511010 (+) | 198 | WP_047386208.1 | hypothetical protein | - |
| Q2310_RS12880 (Q2310_12850) | - | 2511127..2511288 (+) | 162 | WP_047386210.1 | hypothetical protein | - |
| Q2310_RS12885 (Q2310_12855) | - | 2511316..2511798 (+) | 483 | WP_047386212.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| Q2310_RS12890 (Q2310_12860) | - | 2511798..2512340 (+) | 543 | WP_061113366.1 | site-specific integrase | - |
| Q2310_RS12895 (Q2310_12865) | - | 2512555..2513505 (+) | 951 | WP_044307557.1 | nucleoside hydrolase | - |
| Q2310_RS12900 (Q2310_12870) | - | 2513928..2515034 (+) | 1107 | WP_061113367.1 | hypothetical protein | - |
| Q2310_RS12905 (Q2310_12875) | - | 2515395..2515604 (+) | 210 | WP_061113368.1 | hypothetical protein | - |
| Q2310_RS12910 (Q2310_12880) | - | 2515743..2515997 (+) | 255 | WP_061113369.1 | hypothetical protein | - |
| Q2310_RS12915 (Q2310_12885) | - | 2515987..2516364 (+) | 378 | WP_061113370.1 | HNH endonuclease | - |
| Q2310_RS12920 (Q2310_12890) | - | 2516494..2517003 (+) | 510 | WP_029141185.1 | phage terminase small subunit P27 family | - |
| Q2310_RS12925 (Q2310_12895) | - | 2517000..2518694 (+) | 1695 | WP_001235251.1 | terminase large subunit | - |
| Q2310_RS12930 (Q2310_12900) | - | 2518705..2518866 (+) | 162 | WP_001211536.1 | hypothetical protein | - |
| Q2310_RS12935 (Q2310_12905) | - | 2518883..2520136 (+) | 1254 | WP_000577423.1 | phage portal protein | - |
| Q2310_RS12940 (Q2310_12910) | - | 2520123..2520833 (+) | 711 | WP_047386235.1 | head maturation protease, ClpP-related | - |
| Q2310_RS12945 (Q2310_12915) | - | 2520870..2522042 (+) | 1173 | WP_047386237.1 | phage major capsid protein | - |
| Q2310_RS12950 (Q2310_12920) | - | 2522063..2522350 (+) | 288 | WP_000244589.1 | head-tail connector protein | - |
| Q2310_RS12955 (Q2310_12925) | - | 2522337..2522660 (+) | 324 | WP_047386240.1 | phage head closure protein | - |
| Q2310_RS12960 (Q2310_12930) | - | 2522653..2523087 (+) | 435 | WP_047386241.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| Q2310_RS12965 (Q2310_12935) | - | 2523084..2523443 (+) | 360 | WP_047386243.1 | DUF3168 domain-containing protein | - |
| Q2310_RS12970 (Q2310_12940) | - | 2523444..2524049 (+) | 606 | WP_047386244.1 | major tail protein | - |
| Q2310_RS12975 (Q2310_12945) | gpG | 2524099..2524416 (+) | 318 | WP_047386246.1 | phage tail assembly chaperone G | - |
| Q2310_RS12980 (Q2310_12950) | - | 2524446..2524622 (+) | 177 | WP_154642983.1 | hypothetical protein | - |
| Q2310_RS12985 (Q2310_12955) | - | 2524638..2525918 (+) | 1281 | Protein_2480 | phage tail tape measure protein | - |
| Q2310_RS12990 (Q2310_12960) | - | 2526183..2528754 (+) | 2572 | Protein_2481 | phage tail tape measure protein | - |
| Q2310_RS12995 (Q2310_12965) | - | 2528769..2530250 (+) | 1482 | WP_047386250.1 | distal tail protein Dit | - |
| Q2310_RS13000 (Q2310_12970) | - | 2530247..2534257 (+) | 4011 | WP_061113372.1 | phage tail spike protein | - |
| Q2310_RS13005 (Q2310_12975) | - | 2534280..2534729 (+) | 450 | WP_063264107.1 | hypothetical protein | - |
| Q2310_RS13010 (Q2310_12980) | - | 2534901..2535878 (+) | 978 | WP_063264108.1 | HEPN domain-containing protein | - |
| Q2310_RS13015 (Q2310_12985) | - | 2536169..2536405 (+) | 237 | WP_016081457.1 | hemolysin XhlA family protein | - |
| Q2310_RS13020 (Q2310_12990) | - | 2536405..2536644 (+) | 240 | WP_016108980.1 | hypothetical protein | - |
| Q2310_RS13025 (Q2310_12995) | - | 2536641..2537705 (+) | 1065 | WP_061113048.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10177.92 Da Isoelectric Point: 7.2788
>NTDB_id=858646 Q2310_RS12820 WP_061113074.1 2504128..2504406(+) (abrB) [Bacillus cereus strain T]
MKYTGVARKVDELGRVVIPVELRRTLGITEGIALDFHVDGKNIVLRKHEKSCFVTGEVSETNIELLGGRMFLSKEGVIEL
LDLIQKSGMAHA
MKYTGVARKVDELGRVVIPVELRRTLGITEGIALDFHVDGKNIVLRKHEKSCFVTGEVSETNIELLGGRMFLSKEGVIEL
LDLIQKSGMAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=858646 Q2310_RS12820 WP_061113074.1 2504128..2504406(+) (abrB) [Bacillus cereus strain T]
ATGAAATACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
TATTACCGAAGGAATCGCACTAGATTTTCATGTCGATGGTAAAAACATTGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TCACGGGGGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCAGAATGTTTTTAAGCAAGGAAGGGGTAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
ATGAAATACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
TATTACCGAAGGAATCGCACTAGATTTTCATGTCGATGGTAAAAACATTGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TCACGGGGGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCAGAATGTTTTTAAGCAAGGAAGGGGTAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
57.471 |
94.565 |
0.543 |