Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | Q2U85_RS13485 | Genome accession | NZ_CP130335 |
| Coordinates | 2612025..2612303 (+) | Length | 92 a.a. |
| NCBI ID | WP_153588209.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain DW444 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2603112..2646547 | 2612025..2612303 | within | 0 |
Gene organization within MGE regions
Location: 2603112..2646547
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q2U85_RS13415 (Q2U85_13415) | - | 2603112..2603375 (+) | 264 | WP_002082716.1 | DUF3937 domain-containing protein | - |
| Q2U85_RS13420 (Q2U85_13420) | - | 2603929..2604249 (+) | 321 | WP_001071364.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| Q2U85_RS13425 (Q2U85_13425) | - | 2604395..2604529 (+) | 135 | Protein_2574 | site-specific integrase | - |
| Q2U85_RS13430 (Q2U85_13430) | - | 2604739..2605224 (+) | 486 | WP_153588206.1 | homoserine dehydrogenase | - |
| Q2U85_RS13435 (Q2U85_13435) | - | 2605529..2606230 (+) | 702 | WP_000736187.1 | DUF3962 domain-containing protein | - |
| Q2U85_RS13440 (Q2U85_13440) | - | 2606269..2607378 (-) | 1110 | WP_258113035.1 | tyrosine-type recombinase/integrase | - |
| Q2U85_RS13445 (Q2U85_13445) | - | 2607934..2609142 (+) | 1209 | WP_258113034.1 | AimR family lysis-lysogeny pheromone receptor | - |
| Q2U85_RS13450 (Q2U85_13450) | - | 2609169..2609324 (+) | 156 | WP_000790841.1 | hypothetical protein | - |
| Q2U85_RS13455 (Q2U85_13455) | - | 2609588..2609938 (-) | 351 | WP_000367269.1 | helix-turn-helix transcriptional regulator | - |
| Q2U85_RS13460 (Q2U85_13460) | - | 2610125..2610349 (+) | 225 | WP_001192731.1 | helix-turn-helix transcriptional regulator | - |
| Q2U85_RS13465 (Q2U85_13465) | - | 2610390..2610656 (+) | 267 | WP_000522182.1 | helix-turn-helix domain-containing protein | - |
| Q2U85_RS13470 (Q2U85_13470) | - | 2610656..2610811 (+) | 156 | WP_097995375.1 | hypothetical protein | - |
| Q2U85_RS13475 (Q2U85_13475) | - | 2610851..2611027 (+) | 177 | WP_258113033.1 | hypothetical protein | - |
| Q2U85_RS13480 (Q2U85_13480) | - | 2611032..2612021 (+) | 990 | WP_153588208.1 | DnaD domain-containing protein | - |
| Q2U85_RS13485 (Q2U85_13485) | abrB | 2612025..2612303 (+) | 279 | WP_153588209.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| Q2U85_RS13490 (Q2U85_13490) | - | 2612296..2612655 (+) | 360 | WP_098568329.1 | cell division protein SepF | - |
| Q2U85_RS13495 (Q2U85_13495) | - | 2612674..2612841 (+) | 168 | WP_006923988.1 | DUF3954 domain-containing protein | - |
| Q2U85_RS13500 (Q2U85_13500) | - | 2612867..2613118 (+) | 252 | WP_153588210.1 | helix-turn-helix domain containing protein | - |
| Q2U85_RS13505 (Q2U85_13505) | - | 2613138..2613647 (+) | 510 | WP_153588211.1 | dUTP diphosphatase | - |
| Q2U85_RS13510 (Q2U85_13510) | - | 2613793..2614581 (-) | 789 | WP_153588212.1 | sulfotransferase family 2 domain-containing protein | - |
| Q2U85_RS13515 (Q2U85_13515) | - | 2615588..2616154 (+) | 567 | WP_258113110.1 | DUF4183 domain-containing protein | - |
| Q2U85_RS13520 (Q2U85_13520) | - | 2616209..2616499 (-) | 291 | WP_153588213.1 | DUF4183 domain-containing protein | - |
| Q2U85_RS13525 (Q2U85_13525) | - | 2616889..2617188 (-) | 300 | WP_098022880.1 | hypothetical protein | - |
| Q2U85_RS13530 (Q2U85_13530) | - | 2617426..2617548 (+) | 123 | WP_194810904.1 | DUF3983 domain-containing protein | - |
| Q2U85_RS13535 (Q2U85_13535) | - | 2617666..2617836 (+) | 171 | WP_194810905.1 | hypothetical protein | - |
| Q2U85_RS13540 (Q2U85_13540) | - | 2617864..2618346 (+) | 483 | WP_153588215.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| Q2U85_RS13545 (Q2U85_13545) | - | 2618346..2618888 (+) | 543 | WP_153588216.1 | site-specific integrase | - |
| Q2U85_RS13550 (Q2U85_13550) | - | 2619200..2619601 (-) | 402 | WP_098876484.1 | hypothetical protein | - |
| Q2U85_RS13555 (Q2U85_13555) | - | 2620071..2620655 (-) | 585 | WP_153588217.1 | hypothetical protein | - |
| Q2U85_RS13560 (Q2U85_13560) | - | 2621151..2621636 (-) | 486 | WP_048567685.1 | hypothetical protein | - |
| Q2U85_RS13565 (Q2U85_13565) | - | 2622159..2622530 (+) | 372 | WP_141531481.1 | hypothetical protein | - |
| Q2U85_RS13570 (Q2U85_13570) | - | 2622531..2622743 (+) | 213 | WP_048567684.1 | hypothetical protein | - |
| Q2U85_RS13575 (Q2U85_13575) | - | 2622880..2623134 (+) | 255 | WP_048567683.1 | hypothetical protein | - |
| Q2U85_RS13580 (Q2U85_13580) | - | 2623124..2623501 (+) | 378 | WP_048567682.1 | HNH endonuclease | - |
| Q2U85_RS13585 (Q2U85_13585) | - | 2623630..2624133 (+) | 504 | WP_258113032.1 | phage terminase small subunit P27 family | - |
| Q2U85_RS13590 (Q2U85_13590) | - | 2624135..2625829 (+) | 1695 | WP_153588218.1 | terminase large subunit | - |
| Q2U85_RS13595 (Q2U85_13595) | - | 2626018..2627265 (+) | 1248 | WP_302721164.1 | phage portal protein | - |
| Q2U85_RS13600 (Q2U85_13600) | - | 2627360..2628553 (-) | 1194 | WP_000499523.1 | IS110-like element ISBth13 family transposase | - |
| Q2U85_RS13605 (Q2U85_13605) | - | 2628841..2629551 (+) | 711 | WP_258113031.1 | head maturation protease, ClpP-related | - |
| Q2U85_RS13610 (Q2U85_13610) | - | 2629589..2630761 (+) | 1173 | WP_153588220.1 | phage major capsid protein | - |
| Q2U85_RS13615 (Q2U85_13615) | - | 2630782..2631069 (+) | 288 | WP_048567678.1 | head-tail connector protein | - |
| Q2U85_RS13620 (Q2U85_13620) | - | 2631056..2631379 (+) | 324 | WP_137071889.1 | phage head closure protein | - |
| Q2U85_RS13625 (Q2U85_13625) | - | 2631372..2631806 (+) | 435 | WP_006921164.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| Q2U85_RS13630 (Q2U85_13630) | - | 2631803..2632162 (+) | 360 | WP_153588221.1 | DUF3168 domain-containing protein | - |
| Q2U85_RS13635 (Q2U85_13635) | - | 2632163..2632768 (+) | 606 | WP_153588222.1 | major tail protein | - |
| Q2U85_RS13640 (Q2U85_13640) | - | 2632817..2633134 (+) | 318 | WP_075717239.1 | hypothetical protein | - |
| Q2U85_RS13645 (Q2U85_13645) | - | 2633164..2633340 (+) | 177 | WP_153588223.1 | hypothetical protein | - |
| Q2U85_RS30885 | - | 2633356..2634636 (+) | 1281 | Protein_2619 | phage tail tape measure protein | - |
| Q2U85_RS30890 | - | 2634853..2637471 (+) | 2619 | WP_313900966.1 | phage tail tape measure protein | - |
| Q2U85_RS13655 (Q2U85_13655) | - | 2637486..2638967 (+) | 1482 | WP_153588225.1 | distal tail protein Dit | - |
| Q2U85_RS13660 (Q2U85_13660) | - | 2638964..2643001 (+) | 4038 | WP_153588226.1 | phage tail spike protein | - |
| Q2U85_RS13665 (Q2U85_13665) | - | 2643131..2643355 (+) | 225 | WP_000390459.1 | hemolysin XhlA family protein | - |
| Q2U85_RS13670 (Q2U85_13670) | - | 2643428..2643661 (+) | 234 | WP_302721175.1 | hemolysin XhlA family protein | - |
| Q2U85_RS13675 (Q2U85_13675) | - | 2643756..2644949 (-) | 1194 | WP_000499523.1 | IS110-like element ISBth13 family transposase | - |
| Q2U85_RS13680 (Q2U85_13680) | - | 2645247..2645486 (+) | 240 | WP_048567671.1 | hypothetical protein | - |
| Q2U85_RS13685 (Q2U85_13685) | - | 2645483..2646547 (+) | 1065 | WP_153588227.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10129.84 Da Isoelectric Point: 8.0757
>NTDB_id=857998 Q2U85_RS13485 WP_153588209.1 2612025..2612303(+) (abrB) [Bacillus cereus strain DW444]
MKNTGVARKVDELGRVVIPVELRRTLGITKGTALDFHVDGENIVLRKHEKSCFVTGEVSENNIELLGGRMFLSKEGVIEL
LDLIKKSGMAHA
MKNTGVARKVDELGRVVIPVELRRTLGITKGTALDFHVDGENIVLRKHEKSCFVTGEVSENNIELLGGRMFLSKEGVIEL
LDLIKKSGMAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=857998 Q2U85_RS13485 WP_153588209.1 2612025..2612303(+) (abrB) [Bacillus cereus strain DW444]
ATGAAAAATACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGAGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
TATTACCAAAGGAACGGCACTAGATTTCCATGTCGATGGTGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAAATAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGTAATTGAATTA
CTGGATCTTATTAAGAAGAGTGGGATGGCACATGCCTAA
ATGAAAAATACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGAGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
TATTACCAAAGGAACGGCACTAGATTTCCATGTCGATGGTGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAAATAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGTAATTGAATTA
CTGGATCTTATTAAGAAGAGTGGGATGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
56.322 |
94.565 |
0.533 |