Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | Q2U85_RS01970 | Genome accession | NZ_CP130335 |
| Coordinates | 359579..359857 (+) | Length | 92 a.a. |
| NCBI ID | WP_098015094.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain DW444 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 349565..391643 | 359579..359857 | within | 0 |
Gene organization within MGE regions
Location: 349565..391643
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q2U85_RS01885 (Q2U85_01885) | - | 349565..350689 (-) | 1125 | WP_302720430.1 | tyrosine-type recombinase/integrase | - |
| Q2U85_RS01890 (Q2U85_01890) | - | 350975..351685 (+) | 711 | WP_302720431.1 | hypothetical protein | - |
| Q2U85_RS01895 (Q2U85_01895) | - | 351710..351967 (+) | 258 | WP_302720432.1 | hypothetical protein | - |
| Q2U85_RS01900 (Q2U85_01900) | - | 351964..352404 (+) | 441 | WP_302720433.1 | protein-export chaperone SecB | - |
| Q2U85_RS01905 (Q2U85_01905) | - | 352626..353489 (-) | 864 | WP_098451290.1 | hypothetical protein | - |
| Q2U85_RS01910 (Q2U85_01910) | - | 353670..354023 (-) | 354 | WP_061684643.1 | helix-turn-helix domain-containing protein | - |
| Q2U85_RS01915 (Q2U85_01915) | - | 354560..355699 (+) | 1140 | WP_302720434.1 | AimR family lysis-lysogeny pheromone receptor | - |
| Q2U85_RS01920 (Q2U85_01920) | - | 355702..355845 (+) | 144 | WP_172794712.1 | hypothetical protein | - |
| Q2U85_RS01925 (Q2U85_01925) | - | 356068..356190 (+) | 123 | WP_000237931.1 | hypothetical protein | - |
| Q2U85_RS01930 (Q2U85_01930) | - | 356209..356562 (-) | 354 | WP_061684635.1 | helix-turn-helix domain-containing protein | - |
| Q2U85_RS01935 (Q2U85_01935) | - | 356774..357025 (+) | 252 | WP_223618131.1 | helix-turn-helix domain-containing protein | - |
| Q2U85_RS01940 (Q2U85_01940) | - | 357022..357372 (+) | 351 | WP_061684633.1 | helix-turn-helix domain-containing protein | - |
| Q2U85_RS01945 (Q2U85_01945) | - | 357369..357536 (+) | 168 | WP_000568734.1 | hypothetical protein | - |
| Q2U85_RS01950 (Q2U85_01950) | - | 357566..357742 (+) | 177 | WP_080448252.1 | hypothetical protein | - |
| Q2U85_RS01955 (Q2U85_01955) | - | 357747..358538 (+) | 792 | WP_302720435.1 | DnaD domain-containing protein | - |
| Q2U85_RS01960 (Q2U85_01960) | - | 358477..359352 (+) | 876 | WP_302720436.1 | ATP-binding protein | - |
| Q2U85_RS01965 (Q2U85_01965) | - | 359368..359562 (+) | 195 | WP_302720437.1 | hypothetical protein | - |
| Q2U85_RS01970 (Q2U85_01970) | abrB | 359579..359857 (+) | 279 | WP_098015094.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| Q2U85_RS01975 (Q2U85_01975) | - | 359850..360209 (+) | 360 | WP_098015093.1 | cell division protein SepF | - |
| Q2U85_RS01980 (Q2U85_01980) | - | 360229..360396 (+) | 168 | WP_000717829.1 | DUF3954 domain-containing protein | - |
| Q2U85_RS01985 (Q2U85_01985) | - | 360422..360673 (+) | 252 | WP_253621370.1 | helix-turn-helix domain containing protein | - |
| Q2U85_RS01990 (Q2U85_01990) | - | 360694..360909 (+) | 216 | WP_059303850.1 | hypothetical protein | - |
| Q2U85_RS01995 (Q2U85_01995) | - | 360977..361144 (+) | 168 | WP_170962963.1 | hypothetical protein | - |
| Q2U85_RS02000 (Q2U85_02000) | - | 361157..361693 (+) | 537 | WP_302720438.1 | dUTP diphosphatase | - |
| Q2U85_RS02005 (Q2U85_02005) | - | 361903..362223 (+) | 321 | WP_302720439.1 | hypothetical protein | - |
| Q2U85_RS02010 (Q2U85_02010) | - | 362267..362458 (+) | 192 | WP_000283199.1 | hypothetical protein | - |
| Q2U85_RS02015 (Q2U85_02015) | - | 362477..362905 (+) | 429 | WP_302720440.1 | hypothetical protein | - |
| Q2U85_RS02020 (Q2U85_02020) | - | 362942..363445 (+) | 504 | WP_302720441.1 | hypothetical protein | - |
| Q2U85_RS02025 (Q2U85_02025) | - | 363502..363648 (-) | 147 | WP_302720442.1 | hypothetical protein | - |
| Q2U85_RS02030 (Q2U85_02030) | - | 363773..363955 (+) | 183 | WP_302720443.1 | hypothetical protein | - |
| Q2U85_RS02035 (Q2U85_02035) | - | 363992..364174 (+) | 183 | WP_302720444.1 | hypothetical protein | - |
| Q2U85_RS02040 (Q2U85_02040) | - | 364208..364750 (+) | 543 | WP_086409327.1 | DNA cytosine methyltransferase | - |
| Q2U85_RS02045 (Q2U85_02045) | - | 364707..365123 (+) | 417 | WP_263317030.1 | DNA cytosine methyltransferase | - |
| Q2U85_RS02050 (Q2U85_02050) | - | 365158..365442 (+) | 285 | WP_302720445.1 | hypothetical protein | - |
| Q2U85_RS02055 (Q2U85_02055) | - | 365549..365671 (+) | 123 | WP_255262343.1 | hypothetical protein | - |
| Q2U85_RS02060 (Q2U85_02060) | - | 365709..365975 (+) | 267 | WP_059303844.1 | hypothetical protein | - |
| Q2U85_RS02065 (Q2U85_02065) | - | 366087..366257 (+) | 171 | WP_059303843.1 | hypothetical protein | - |
| Q2U85_RS02070 (Q2U85_02070) | - | 366278..366748 (+) | 471 | WP_059303842.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| Q2U85_RS02075 (Q2U85_02075) | - | 366745..367287 (+) | 543 | WP_001028525.1 | site-specific integrase | - |
| Q2U85_RS02080 (Q2U85_02080) | - | 367498..367887 (+) | 390 | WP_302720446.1 | hypothetical protein | - |
| Q2U85_RS02085 (Q2U85_02085) | - | 368322..368582 (+) | 261 | WP_302720447.1 | hypothetical protein | - |
| Q2U85_RS02090 (Q2U85_02090) | - | 368606..369013 (+) | 408 | WP_302720448.1 | hypothetical protein | - |
| Q2U85_RS02095 (Q2U85_02095) | - | 369027..369299 (+) | 273 | WP_302720449.1 | hypothetical protein | - |
| Q2U85_RS02100 (Q2U85_02100) | - | 369292..369660 (+) | 369 | WP_098208020.1 | HNH endonuclease | - |
| Q2U85_RS02105 (Q2U85_02105) | - | 369822..370202 (+) | 381 | WP_000357492.1 | phage terminase small subunit P27 family | - |
| Q2U85_RS02110 (Q2U85_02110) | - | 370183..371955 (+) | 1773 | WP_196478150.1 | terminase large subunit | - |
| Q2U85_RS02115 (Q2U85_02115) | - | 371971..373185 (+) | 1215 | WP_216115449.1 | phage portal protein | - |
| Q2U85_RS02120 (Q2U85_02120) | - | 373163..373918 (+) | 756 | WP_302720450.1 | head maturation protease, ClpP-related | - |
| Q2U85_RS02125 (Q2U85_02125) | - | 373915..375102 (+) | 1188 | WP_000782638.1 | phage major capsid protein | - |
| Q2U85_RS02130 (Q2U85_02130) | - | 375077..375379 (+) | 303 | WP_141769786.1 | fibronectin type III domain-containing protein | - |
| Q2U85_RS02135 (Q2U85_02135) | - | 375388..375663 (+) | 276 | WP_098218087.1 | head-tail connector protein | - |
| Q2U85_RS02140 (Q2U85_02140) | - | 375650..375997 (+) | 348 | WP_140161590.1 | phage head closure protein | - |
| Q2U85_RS02145 (Q2U85_02145) | - | 375985..376422 (+) | 438 | WP_302720451.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| Q2U85_RS02150 (Q2U85_02150) | - | 376419..376778 (+) | 360 | WP_302720452.1 | structural protein | - |
| Q2U85_RS02155 (Q2U85_02155) | - | 376792..377376 (+) | 585 | WP_000952021.1 | major tail protein | - |
| Q2U85_RS02160 (Q2U85_02160) | - | 377436..377831 (+) | 396 | WP_142317748.1 | hypothetical protein | - |
| Q2U85_RS02165 (Q2U85_02165) | - | 377849..377989 (+) | 141 | WP_000938713.1 | hypothetical protein | - |
| Q2U85_RS02170 (Q2U85_02170) | - | 378005..383020 (+) | 5016 | WP_302720453.1 | phage tail tape measure protein | - |
| Q2U85_RS02175 (Q2U85_02175) | - | 383055..384518 (+) | 1464 | WP_302720454.1 | distal tail protein Dit | - |
| Q2U85_RS02180 (Q2U85_02180) | - | 384515..389044 (+) | 4530 | WP_302720455.1 | phage tail spike protein | - |
| Q2U85_RS02185 (Q2U85_02185) | - | 389060..389431 (+) | 372 | WP_050822064.1 | hypothetical protein | - |
| Q2U85_RS02190 (Q2U85_02190) | - | 389533..390492 (+) | 960 | WP_142320590.1 | site-specific integrase | - |
| Q2U85_RS02195 (Q2U85_02195) | - | 390508..390933 (+) | 426 | WP_000373869.1 | holin family protein | - |
| Q2U85_RS02200 (Q2U85_02200) | - | 390933..391643 (+) | 711 | WP_302720456.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10050.54 Da Isoelectric Point: 5.1693
>NTDB_id=857976 Q2U85_RS01970 WP_098015094.1 359579..359857(+) (abrB) [Bacillus cereus strain DW444]
MKNTGVTRKVDELGRVVIPIELRRNLGIAEGTALGFHVEGEDIVLRKQDKSCFVTGEVSESNIELLNGRMFLSKEGATEL
LDILEKSGIAHG
MKNTGVTRKVDELGRVVIPIELRRNLGIAEGTALGFHVEGEDIVLRKQDKSCFVTGEVSESNIELLNGRMFLSKEGATEL
LDILEKSGIAHG
Nucleotide
Download Length: 279 bp
>NTDB_id=857976 Q2U85_RS01970 WP_098015094.1 359579..359857(+) (abrB) [Bacillus cereus strain DW444]
ATGAAAAATACAGGCGTTACAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATTCCGATAGAGTTACGCAGAAATTTAGG
AATTGCTGAAGGTACAGCATTAGGATTTCATGTTGAAGGGGAAGATATCGTTTTAAGAAAACAGGATAAGTCATGCTTTG
TAACTGGTGAAGTTTCTGAATCAAACATTGAATTGCTGAATGGAAGAATGTTTCTAAGTAAAGAAGGAGCAACTGAATTA
CTGGACATTCTTGAAAAGAGTGGAATAGCACATGGCTAA
ATGAAAAATACAGGCGTTACAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATTCCGATAGAGTTACGCAGAAATTTAGG
AATTGCTGAAGGTACAGCATTAGGATTTCATGTTGAAGGGGAAGATATCGTTTTAAGAAAACAGGATAAGTCATGCTTTG
TAACTGGTGAAGTTTCTGAATCAAACATTGAATTGCTGAATGGAAGAATGTTTCTAAGTAAAGAAGGAGCAACTGAATTA
CTGGACATTCTTGAAAAGAGTGGAATAGCACATGGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
59.036 |
90.217 |
0.533 |