Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | Q2483_RS14725 | Genome accession | NZ_CP130321 |
| Coordinates | 2998374..2998514 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain NC-B4 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2993374..3003514
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q2483_RS14700 (Q2483_14700) | - | 2993720..2994103 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| Q2483_RS14705 (Q2483_14705) | comA | 2994125..2994769 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| Q2483_RS14710 (Q2483_14710) | comP | 2994850..2997150 (-) | 2301 | WP_032876801.1 | histidine kinase | Regulator |
| Q2483_RS14715 (Q2483_14715) | comX | 2997164..2997337 (-) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| Q2483_RS14720 (Q2483_14720) | - | 2997306..2998166 (-) | 861 | WP_142925231.1 | polyprenyl synthetase family protein | - |
| Q2483_RS14725 (Q2483_14725) | degQ | 2998374..2998514 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| Q2483_RS14730 (Q2483_14730) | - | 2998980..2999321 (+) | 342 | WP_032876795.1 | hypothetical protein | - |
| Q2483_RS14735 (Q2483_14735) | - | 2999328..3000551 (-) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| Q2483_RS14740 (Q2483_14740) | - | 3000681..3002147 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| Q2483_RS14745 (Q2483_14745) | - | 3002165..3002716 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| Q2483_RS14750 (Q2483_14750) | - | 3002813..3003211 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=857837 Q2483_RS14725 WP_003152043.1 2998374..2998514(-) (degQ) [Bacillus velezensis strain NC-B4]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=857837 Q2483_RS14725 WP_003152043.1 2998374..2998514(-) (degQ) [Bacillus velezensis strain NC-B4]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |