Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   Q2B68_RS13310 Genome accession   NZ_CP130280
Coordinates   2708535..2708708 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain PM415     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2703535..2713708
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q2B68_RS13295 (Q2B68_13295) gcvT 2704352..2705452 (-) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -
  Q2B68_RS13300 (Q2B68_13300) - 2705876..2707546 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  Q2B68_RS13305 (Q2B68_13305) - 2707564..2708358 (+) 795 WP_003153106.1 YqhG family protein -
  Q2B68_RS13310 (Q2B68_13310) sinI 2708535..2708708 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  Q2B68_RS13315 (Q2B68_13315) sinR 2708742..2709077 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  Q2B68_RS13320 (Q2B68_13320) tasA 2709125..2709910 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  Q2B68_RS13325 (Q2B68_13325) sipW 2709974..2710558 (-) 585 WP_012117977.1 signal peptidase I SipW -
  Q2B68_RS13330 (Q2B68_13330) tapA 2710530..2711201 (-) 672 WP_165625718.1 amyloid fiber anchoring/assembly protein TapA -
  Q2B68_RS13335 (Q2B68_13335) - 2711460..2711789 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  Q2B68_RS13340 (Q2B68_13340) - 2711829..2712008 (-) 180 WP_003153093.1 YqzE family protein -
  Q2B68_RS13345 (Q2B68_13345) comGG 2712065..2712442 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  Q2B68_RS13350 (Q2B68_13350) comGF 2712443..2712943 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  Q2B68_RS13355 (Q2B68_13355) comGE 2712852..2713166 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  Q2B68_RS13360 (Q2B68_13360) comGD 2713150..2713587 (-) 438 WP_224462754.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=857553 Q2B68_RS13310 WP_003153105.1 2708535..2708708(+) (sinI) [Bacillus amyloliquefaciens strain PM415]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=857553 Q2B68_RS13310 WP_003153105.1 2708535..2708708(+) (sinI) [Bacillus amyloliquefaciens strain PM415]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702