Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   V6U69_RS00735 Genome accession   NZ_CP145867
Coordinates   134687..134917 (+) Length   76 a.a.
NCBI ID   WP_002887015.1    Uniprot ID   -
Organism   Streptococcus salivarius strain KSS10     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 129687..139917
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6U69_RS00710 (V6U69_00710) - 131579..131941 (+) 363 WP_002885749.1 DUF1033 family protein -
  V6U69_RS00715 (V6U69_00715) comGA 132021..132962 (+) 942 WP_002885658.1 competence type IV pilus ATPase ComGA Machinery gene
  V6U69_RS00720 (V6U69_00720) comGB 132844..133944 (+) 1101 WP_155115607.1 competence type IV pilus assembly protein ComGB Machinery gene
  V6U69_RS00725 (V6U69_00725) comGC 133953..134267 (+) 315 WP_037611125.1 competence type IV pilus major pilin ComGC Machinery gene
  V6U69_RS00730 (V6U69_00730) comGD 134227..134655 (+) 429 WP_260312930.1 competence type IV pilus minor pilin ComGD Machinery gene
  V6U69_RS00735 (V6U69_00735) comGE 134687..134917 (+) 231 WP_002887015.1 competence type IV pilus minor pilin ComGE Machinery gene
  V6U69_RS00740 (V6U69_00740) comGF 134904..135341 (+) 438 WP_022496100.1 competence type IV pilus minor pilin ComGF Machinery gene
  V6U69_RS00745 (V6U69_00745) comGG 135319..135636 (+) 318 WP_021144683.1 competence type IV pilus minor pilin ComGG Machinery gene
  V6U69_RS00750 (V6U69_00750) comGH 135681..136637 (+) 957 WP_410533909.1 class I SAM-dependent methyltransferase Machinery gene
  V6U69_RS00755 (V6U69_00755) - 136694..137887 (+) 1194 WP_410533911.1 acetate kinase -
  V6U69_RS00760 (V6U69_00760) - 138138..138335 (+) 198 WP_013991261.1 helix-turn-helix transcriptional regulator -
  V6U69_RS00765 (V6U69_00765) - 138347..139003 (+) 657 WP_410533913.1 CPBP family intramembrane glutamic endopeptidase -
  V6U69_RS00770 (V6U69_00770) - 139077..139523 (+) 447 WP_410533915.1 CAAX protease -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8399.78 Da        Isoelectric Point: 10.0924

>NTDB_id=853916 V6U69_RS00735 WP_002887015.1 134687..134917(+) (comGE) [Streptococcus salivarius strain KSS10]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSQQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=853916 V6U69_RS00735 WP_002887015.1 134687..134917(+) (comGE) [Streptococcus salivarius strain KSS10]
ATGGCTGTCTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CGGTAAAACGTAGCCAGCAAGGTATCGCGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

39.189

97.368

0.382

  comGE Streptococcus mutans UA159

39.189

97.368

0.382