Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   V6U65_RS09295 Genome accession   NZ_CP145863
Coordinates   2008130..2008360 (-) Length   76 a.a.
NCBI ID   WP_002887015.1    Uniprot ID   -
Organism   Streptococcus salivarius strain KSS6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2003130..2013360
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6U65_RS09260 (V6U65_09255) - 2003520..2003966 (-) 447 WP_021144682.1 hypothetical protein -
  V6U65_RS09265 (V6U65_09260) - 2004044..2004700 (-) 657 WP_410532390.1 CPBP family intramembrane glutamic endopeptidase -
  V6U65_RS09270 (V6U65_09265) - 2004712..2004909 (-) 198 WP_014635114.1 helix-turn-helix transcriptional regulator -
  V6U65_RS09275 (V6U65_09270) - 2005160..2006353 (-) 1194 WP_014635115.1 acetate kinase -
  V6U65_RS09280 (V6U65_09275) comGH 2006410..2007366 (-) 957 WP_002885753.1 class I SAM-dependent methyltransferase Machinery gene
  V6U65_RS09285 (V6U65_09280) comGG 2007411..2007728 (-) 318 WP_021144683.1 competence type IV pilus minor pilin ComGG Machinery gene
  V6U65_RS09290 (V6U65_09285) comGF 2007706..2008143 (-) 438 WP_021144684.1 competence type IV pilus minor pilin ComGF Machinery gene
  V6U65_RS09295 (V6U65_09290) comGE 2008130..2008360 (-) 231 WP_002887015.1 competence type IV pilus minor pilin ComGE Machinery gene
  V6U65_RS09300 (V6U65_09295) comGD 2008392..2008820 (-) 429 WP_254593949.1 competence type IV pilus minor pilin ComGD Machinery gene
  V6U65_RS09305 (V6U65_09300) comGC 2008780..2009094 (-) 315 WP_170314557.1 competence type IV pilus major pilin ComGC Machinery gene
  V6U65_RS09310 (V6U65_09305) comGB 2009103..2010203 (-) 1101 WP_410533115.1 competence type IV pilus assembly protein ComGB Machinery gene
  V6U65_RS09315 (V6U65_09310) comGA 2010085..2011026 (-) 942 WP_410532391.1 competence type IV pilus ATPase ComGA Machinery gene
  V6U65_RS09320 (V6U65_09315) - 2011106..2011468 (-) 363 WP_002885749.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8399.78 Da        Isoelectric Point: 10.0924

>NTDB_id=853547 V6U65_RS09295 WP_002887015.1 2008130..2008360(-) (comGE) [Streptococcus salivarius strain KSS6]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSQQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=853547 V6U65_RS09295 WP_002887015.1 2008130..2008360(-) (comGE) [Streptococcus salivarius strain KSS6]
ATGGCTGTCTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CGGTAAAACGTAGCCAGCAAGGTATCGCGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

39.189

97.368

0.382

  comGE Streptococcus mutans UA159

39.189

97.368

0.382