Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QY487_RS14580 Genome accession   NZ_CP129459
Coordinates   2975001..2975141 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SSF6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2970001..2980141
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QY487_RS14555 (QY487_14555) - 2970329..2970712 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  QY487_RS14560 (QY487_14560) comA 2970734..2971378 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  QY487_RS14565 (QY487_14565) comP 2971459..2973762 (-) 2304 WP_220181546.1 histidine kinase Regulator
  QY487_RS14570 (QY487_14570) comX 2973774..2973938 (-) 165 WP_007613432.1 competence pheromone ComX -
  QY487_RS14575 (QY487_14575) - 2973938..2974849 (-) 912 WP_031378407.1 polyprenyl synthetase family protein -
  QY487_RS14580 (QY487_14580) degQ 2975001..2975141 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  QY487_RS14585 (QY487_14585) - 2975606..2975947 (+) 342 WP_014305721.1 hypothetical protein -
  QY487_RS14590 (QY487_14590) - 2975954..2977174 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  QY487_RS14595 (QY487_14595) - 2977304..2978770 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  QY487_RS14600 (QY487_14600) - 2978788..2979339 (-) 552 WP_146275407.1 isochorismatase family cysteine hydrolase -
  QY487_RS14605 (QY487_14605) - 2979436..2979834 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=853477 QY487_RS14580 WP_003152043.1 2975001..2975141(-) (degQ) [Bacillus velezensis strain SSF6]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=853477 QY487_RS14580 WP_003152043.1 2975001..2975141(-) (degQ) [Bacillus velezensis strain SSF6]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891